KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07525Help
Entry
BANAN_07525       CDS       T02047                                 

Definition
(GenBank) pullulanase precursor
  KO
K01200  pullulanase [EC:3.2.1.41]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00500  Starch and sucrose metabolism
bni01100  Metabolic pathways
bni01110  Biosynthesis of secondary metabolites
Module
bni_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:bni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BANAN_07525
Enzymes [BR:bni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.41  pullulanase
     BANAN_07525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_48 DUF3459 GHL5
Motif
Other DBs
NCBI-ProteinID: AFI63704
Position
complement(1831704..1833803)
Genome map
AA seq 699 aa AA seqDB search
MALAQQSEGLKAGVAEPFPLSLERELGAVVHDHGTQFAIWAPSAKSVTLRFFTKGSSMED
GDVMVGTHQPELQSDGAWTIHFDENLHGTYYDYLVEQQDGNLARTADPWAKGAGVNGRRS
MVVDLARTDPAGWEHDEHLTTPLGETMVAEMHVASFSANPHGGFPLEHCGKYLAFTDLGT
TVDGKGKFPTGIDYFKQLGVTAIQLLPFYDYGSVDENDPRQYNWGYDPLNYNVPEGSYST
DPFDGTVRITECKQMIQSLHAQGFKVIMDVVYNHMYTADNWFERVVPGYFVRRNADGTLS
NGSGCGDDMASERAMMRRYIVDSVTYWAREYHIDGFRFDLMGLIDTDTMNAVRRSLDALP
GGKDLIMYGEPWAAGLSSTLPGTELANKEGLHLLDPRIGHFCDRTRDAIKGHVFERQIKG
YVNGNAHDTKPQIELAVDAWRTPETNEGNAGQIIQYVSAHDDWTLWDKLCLSMIGDGSPE
SANKAESEYADDSHRTLESRDDALERAYRAEPGPQTHKVLEANTLAVGLIYTAAGIPFML
AGEEFGKTKFGNDNSFNSGVKVNELDWARAERMQGLVDYYRRLIAVRRANPSLFDAEHIA
VEAPGNAVAYRSDDVAVLVNPDDEEYSLPVERIDSAFADSLHDDLPEAPEFASHAEERWV
CVLDSSGTSTGEFRQTGMRIAGGRFPMPARTLSIWKCER
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggcactcgcacagcaatccgaaggattgaaggcgggtgtcgcagaaccgttcccattg
agtctggaacgtgaactgggtgctgtggtacacgaccatggcacccagttcgcaatctgg
gccccgtcggcgaagtctgtgacactgcgcttcttcaccaaaggttccagcatggaggac
ggcgacgtcatggtgggcacccaccagcccgaactgcaaagcgacggcgcgtggacgatc
catttcgacgagaacctgcacggcacctactacgactacttggtggaacaacaggacggc
aacctggcgcgcaccgccgacccgtgggccaaaggcgccggtgtgaacggccggcgcagc
atggtggtcgacctcgcgcgcaccgacccggccggctgggagcacgacgagcacctgacc
accccgttgggcgagacgatggtggccgagatgcacgtggccagcttcagcgcgaacccg
catggcggtttcccgctcgaacactgcggcaaatacctggccttcaccgaccttggcacc
accgtggacggcaaggggaagttccccacgggcatcgactacttcaaacagctcggcgtc
accgcgatccagctgctgccgttctacgactacggttccgtggacgagaacgatccgagg
cagtacaactggggctacgacccgcttaactacaacgttccggagggctcctactcgacg
gacccgttcgacggcaccgtgcgcatcaccgaatgcaagcagatgatccaatcgctgcac
gcccaaggcttcaaggtgatcatggacgtggtgtacaaccacatgtacacggccgacaac
tggttcgaacgcgtggtgcccggctatttcgtgcgacgcaacgccgacggcacgctgtcg
aacggttccggctgcggcgacgacatggccagcgaacgcgcgatgatgcgccgctacatc
gtggactccgtcacctactgggcgcgcgaataccacatcgacggcttccgcttcgacctc
atggggctcatagacaccgacacgatgaacgcggtgcgcaggtcgctcgacgcgctgccc
ggaggcaaggacctcatcatgtacggcgagccgtgggccgccggactgagctccacattg
cctggcaccgagcttgcgaacaaggagggcctgcatctgctcgacccgcgcatcggccat
ttctgcgaccgcacgcgcgacgcgatcaaggggcatgtgttcgaacgccagatcaaaggc
tatgtgaacggcaacgcgcacgataccaagccgcagatcgagctcgccgtggacgcatgg
cgcacgcccgagaccaacgaaggcaatgccgggcagattatccagtacgtctctgcccac
gacgactggacgctgtgggacaagctgtgcctgagcatgatcggtgacggctcgccggaa
tctgcgaataaagcggaatccgagtatgccgatgactcgcacagaacgctggaatctcgc
gacgacgcgctcgaacgcgcctaccgcgcggaacccggcccgcagacccacaaggtgctc
gaggcgaacacgctcgccgtcggactcatctacacggccgcgggcatcccattcatgctc
gccggcgaggaattcggcaaaacgaagttcggcaacgacaactcattcaactcgggtgtc
aaggtgaacgaactcgattgggcgcgcgccgaacgcatgcagggcctcgtggactactac
cgccgcctgatcgccgtgcgtcgcgcgaatccgagcctgttcgacgccgaacacatcgcc
gtggaggcgccgggcaacgcggtcgcctaccgcagcgacgacgtcgccgtgctcgtcaat
ccggacgacgaggaatacagtctgccggtcgagcgcatcgattccgcgtttgccgacagt
ctgcacgacgatctgcccgaagcgccggaatttgcgagccacgcggaagaacggtgggtg
tgcgtgctcgattcgagcggcacgtcgaccggcgagttccggcagacgggcatgcggatc
gccggcggaagattcccgatgcccgctcgcacactgagcatatggaaatgtgaacgctga

DBGET integrated database retrieval system