KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07530Help
Entry
BANAN_07530       CDS       T02047                                 

Definition
(GenBank) putative sugar ABC transport system membrane protein
  KO
K15772  arabinogalactan oligomer / maltooligosaccharide transport system permease protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni02010  ABC transporters
Module
bni_M00491  arabinogalactan oligomer/maltooligosaccharide transport system
Brite
KEGG Orthology (KO) [BR:bni00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BANAN_07530
Transporters [BR:bni02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    BANAN_07530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Glycophorin_A
Motif
Other DBs
NCBI-ProteinID: AFI63705
Position
complement(1833808..1834776)
Genome map
AA seq 322 aa AA seqDB search
MSNATKAQAKASEAYAEAVDKRVDSELADAHNAQRQSFWKDQKSRRILGDVLTYVLLTVL
GIIWLLPIVWIFLESFNKNTAPFTDTFFPTQYSFDSYITLFTQRNVLDFPRMFMNTFIIA
VFTCIISVFFVLSVAYVMSRMRFHGRRFFMNFVLILGMFPGIMSVVAIYFILKAMGLTGD
GTTILALILVYSAGTGAGFYVMKGYMDTIPTSLDEAAMLDGCTRWQVFWIIIVPICRPMI
VYQAIVGFLTPWLDFVMAKVIARTQENYTASLGLWLMLDKEYINNWFGRFAAAAVLISIP
IAILFIVMQRFYQESMSGSVKG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaatgcaaccaaggcgcaggccaaggcctccgaggcatatgccgaggccgtcgac
aagcgtgtcgattcggagcttgcagatgcgcacaacgcacaacgacagagtttctggaag
gatcagaagtcacgccgtattctcggtgacgtgctcacctacgtgctgctgacggtgctc
ggcatcatatggttgttgccgatcgtatggatcttcctcgaaagcttcaacaagaacacg
gccccgttcaccgacacgttcttcccgacgcagtactcgttcgacagctacatcacgctg
ttcacgcagcgtaacgtgctcgacttcccgcgcatgttcatgaacacgttcatcattgcg
gtcttcacctgcatcatctccgtgttcttcgtgctctccgtcgcctacgtgatgagccgc
atgcgtttccacggccgtaggttcttcatgaacttcgtgctcattctgggcatgttcccg
ggcatcatgtcggtggtcgccatctacttcattctcaaggcgatgggcctgaccggcgac
ggcacgacgatcctcgcgcttattctggtttattcggccggcaccggtgcgggcttctac
gtgatgaagggctacatggacacgatcccgacctcgctggacgaggcggccatgctcgat
ggctgcacccgttggcaggtgttctggatcatcatcgtgccgatctgccgcccgatgatc
gtgtaccaggcgatcgtcggcttcctgaccccatggctcgacttcgtcatggcgaaggtg
atcgcccgcacccaggagaactacacggcttccctgggcctgtggctcatgctcgacaag
gagtacatcaacaactggttcggtcgcttcgcggcggccgcggtgctcatctcgatcccg
atcgcgatcctgttcatcgtgatgcagcgcttctaccaggagtcgatgtccggttcagtg
aagggatga

DBGET integrated database retrieval system