KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07560Help
Entry
BANAN_07560       CDS       T02047                                 

Definition
(GenBank) MalG-type ABC sugar transport system permease component
  KO
K10119  raffinose/stachyose/melibiose transport system permease protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni02010  ABC transporters
Module
bni_M00196  Raffinose/stachyose/melibiose transport system
Brite
KEGG Orthology (KO) [BR:bni00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BANAN_07560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bni02000]
    BANAN_07560
Transporters [BR:bni02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    BANAN_07560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AFI63711
Position
complement(1843965..1844801)
Genome map
AA seq 278 aa AA seqDB search
MQEKPKHGALWTIFFSMISIAWVFPIFLVLLNSFKGKAYISRNAFAFPVGDTFVGLENYK
RGIESTNFFASFGWTVLITVGSVCLILVCTSMCAWWIVRVNNWAAKLLYTLFLFNMIVPF
QMVMFTLSKLADMLKLNTPWGLCFIYLGFGAGLAVFIFTGVVKGIPQSLEESAMIDGASV
PRIFFQVVVPIMKPSIVSVAILEAMWVWNDYLLPYLTLDLGKYKTISVAVQYLKGGYGSV
DMGAMMACLVLAIIPIIVFYLICQKYIVKGVMAGAVKG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagaaaccaaagcacggagcattgtggacgatcttcttctcgatgatctccatt
gcctgggtgttccccatcttcctggtgctgctcaactcgttcaaaggcaaggcatacatc
tcgcgcaacgccttcgcgttcccggtgggcgacacgttcgtcggactcgagaactacaag
cgcggcattgaatccacgaacttcttcgccagcttcggctggacggtgctcatcaccgtc
ggctcggtgtgcctcattctcgtgtgcacgtcgatgtgtgcgtggtggatcgtgcgcgtg
aacaactgggctgccaagctgctctacacgttgttcctgttcaacatgatcgtgccgttc
cagatggtcatgttcacgctgtcgaagctcgccgacatgctgaagctcaacaccccgtgg
ggcctgtgcttcatctacctgggcttcggcgccggtctggcggtgttcattttcaccggc
gtggtcaagggcatcccgcagtcgctggaggagtccgccatgatcgacggtgcctcggtg
ccgcgcatcttcttccaggtggtcgtgccgatcatgaagccgtccatcgtctccgtggcc
atccttgaggccatgtgggtgtggaacgactacctgctgccatacctgacgctcgatctg
ggcaagtacaagaccatctcggtggctgtgcagtacctgaagggcggctatggctccgtc
gacatgggtgcgatgatggcctgcctcgtgctcgcgatcattccgatcatcgtgttctac
ctcatctgccagaagtacatcgtcaagggtgtcatggctggtgccgtaaagggctga

DBGET integrated database retrieval system