KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07615Help
Entry
BANAN_07615       CDS       T02047                                 

Definition
(GenBank) addiction module toxin, RelE/StbE family protein
  KO
K19157  mRNA interferase YafQ [EC:3.1.-.-]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:bni02048]
    BANAN_07615
Enzymes [BR:bni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BANAN_07615
Prokaryotic defense system [BR:bni02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YafQ-dinJ
    BANAN_07615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YafQ_toxin PelD_GGDEF
Motif
Other DBs
NCBI-ProteinID: AFI63722
Position
complement(1864021..1864245)
Genome map
AA seq 74 aa AA seqDB search
MARLEADYTSAFRRDVKRLQRKHADLTELKNVIRLVLENTEESKEILRVRHRAHRLKGKD
WQGVVECHVGNAGD
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggttggaagcggactacacatcggcttttcgtcgtgacgtcaagcgactgcag
cgcaaacacgccgatctgacggagctgaagaacgtcatacgtctggtcctggagaacacg
gaggaatccaaggagatcctgcgcgtccggcatcgagcgcaccgactcaaaggcaaggat
tggcaaggtgtggttgagtgtcatgtgggcaacgcgggcgattga

DBGET integrated database retrieval system