KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07620Help
Entry
BANAN_07620       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
  KO
K07473  DNA-damage-inducible protein J
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bni02048]
    BANAN_07620
Prokaryotic defense system [BR:bni02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YafQ-dinJ
    BANAN_07620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RelB
Motif
Other DBs
NCBI-ProteinID: AFI63723
Position
complement(1864248..1864517)
Genome map
AA seq 89 aa AA seqDB search
MSMTSVTVRVDEDTKKQASDIAEDFGFDLSSVTRAFYRQIVRERRIPLNLSYSNVPEETL
EALAEARRMAKEGAPRFQDADAMFDSLGI
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgacatcggtcacggtccgggttgacgaggatacgaagaagcaggcttctgac
atcgcagaggatttcggtttcgacctgtcgagtgtcacgcgcgcgttttaccggcagatc
gtgcgtgagcggcgcatcccattgaatctgtcctacagcaacgttcccgaggaaacgttg
gaagcattggctgaagcgcgacgcatggccaaggagggggcgcctcggttccaggatgcc
gacgcgatgttcgattcgttgggaatctga

DBGET integrated database retrieval system