KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07625Help
Entry
BANAN_07625       CDS       T02047                                 

Definition
(GenBank) NAD-dependent protein deacetylase
  KO
K12410  NAD-dependent deacetylase [EC:3.5.1.-]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BANAN_07625
Enzymes [BR:bni01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     BANAN_07625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIR2
Motif
Other DBs
NCBI-ProteinID: AFI63724
Position
1870864..1871622
Genome map
AA seq 252 aa AA seqDB search
MAQKQIVVLTGAGISTSAGIPDFRGPDGVWTKHPDQMQVYDIDAFLTDKEAREYSWRWQK
ESPVWNAKPGKAHYALVDLEKAGMLSLIATQNFDALHEKAGNSPSKIVNLHGTIGTSHCM
KCHAKYDTADIMARLDEEPDPHCHRQLPYRGNMPCNGLLKTDVVYFGEALPEGAMERSIR
AAQQADELWVVGSTLEVFPAASIVPAAAQAGVPITIMNMGRTQYDSLATRLIHEDIAVAL
PELVQRTIADNR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaaacagatcgtggtactcaccggcgcgggaatctccacttcggcgggaatt
ccggacttccgcgggccggacggcgtatggaccaagcacccggaccagatgcaggtgtac
gacatcgatgcgttcctcaccgataaagaggcgcgcgaatactcctggcgttggcagaaa
gagtccccggtgtggaacgcgaaaccgggcaaagcgcattatgcactcgtcgacctcgag
aaagcgggcatgctcagtctcatcgccacgcagaacttcgacgcactgcacgaaaaggcg
gggaattcgccgagcaagatcgtgaatctgcacggcaccatcggcacgtcgcactgcatg
aagtgccatgcgaaatatgacaccgcagacatcatggcacggcttgacgaggagccggat
ccgcattgccatcgccagctgccgtaccgcgggaacatgccctgcaacgggctgctcaag
acggacgtcgtctacttcggcgaagcgctgccggaaggcgcgatggaacggtctatccgc
gccgcacagcaggccgacgaactgtgggtggtcgggtccacgctcgaagtgttccccgcg
gcgtcgattgttccggccgcggctcaggcgggagtgccgatcaccatcatgaacatgggt
cgcacacagtacgattcgctcgccacgcgcctcattcacgaagacatcgcggtggcgctg
ccggagctcgtgcagcggaccatcgcagacaacaggtga

DBGET integrated database retrieval system