KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07665Help
Entry
BANAN_07665       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFI63732
Position
1883294..1883416
Genome map
AA seq 40 aa AA seqDB search
MRYPQTPARSTPAAQSAERVAGYFTAPRITPPTTHFWAKM
NT seq 123 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacccgcagacgcccgcccgctccactcccgcagcgcagtcggcagaacgggtc
gcgggttacttcacggcgccgcgcatcacaccgccgacgacccacttctgggcgaagatg
tag

DBGET integrated database retrieval system