KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07670Help
Entry
BANAN_07670       CDS       T02047                                 

Definition
(GenBank) multiple sugar transport system permease protein
  KO
K10119  raffinose/stachyose/melibiose transport system permease protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni02010  ABC transporters
Module
bni_M00196  Raffinose/stachyose/melibiose transport system
Brite
KEGG Orthology (KO) [BR:bni00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BANAN_07670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bni02000]
    BANAN_07670
Transporters [BR:bni02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    BANAN_07670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF21
Motif
Other DBs
NCBI-ProteinID: AFI63733
Position
complement(1883359..1884264)
Genome map
AA seq 301 aa AA seqDB search
MTTATANTMSQQSAQQSATMNTAPAKAEKFRKDRRINWWLTAVVAVFSLTILVPLYFTVV
TALKTPAEAGSFSLPTSWQWGNFAAASAKVDYPRAALNSAIITVLAVSLTLVTNTFVAYA
IARNMDKRFFRFLYYFFIAAMFVPFPVVMLPLAKQMGSWHLDNQAGLIVLYVILGLGTNL
FIATGFIRSIPVSLEEAARIDGAGTWRIFWKIIFPLMGPINATIAIMTALWAWNDFLLPL
IILTDQSNQTIPLAQYVFSSQFATNYPQAFASYLMAMAPVLVVYIFAQKWVVGGVMRGAV
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgcaaccgcaaacaccatgtcgcagcagtctgcgcaacaatctgcaaccatg
aataccgcgccggccaaagcggagaagttccgcaaggaccgccgcatcaattggtggctc
accgcggtcgtcgccgtgttcagcctcacgattctcgtgccgctgtatttcaccgtggtc
accgcattgaagacgccggcggaggcgggctcgttctcgctgccgacgagctggcagtgg
ggcaacttcgcggccgcctcggccaaagtggactacccgcgcgccgcgctcaactcggcg
atcatcaccgtgctcgccgtctcgctcacgctcgtgacgaacaccttcgtcgcctacgcg
atcgcgcgcaacatggacaagcgtttcttccgcttcctctactacttcttcatcgctgcg
atgttcgtgccgttcccggtggtcatgctgccgctcgccaagcagatgggctcgtggcac
ctcgacaaccaggccggcctgattgtcttgtacgtgattctcggccttggcacgaacctg
ttcatcgccaccggattcattcgctcaatcccggtgtcgctcgaagaggccgcgcgcatc
gacggcgcgggcacatggcgcatcttctggaagatcatcttcccgctcatggggcccatt
aacgcgacgattgcgatcatgaccgcactgtgggcatggaacgacttcctgctcccgctt
atcatcctcaccgatcagagcaaccagaccatcccgctcgcacagtatgtgttcagctcg
cagttcgccacgaactacccgcaggcgttcgcgagctacctgatggccatggcccccgtg
ctcgtcgtctacatcttcgcccagaagtgggtcgtcggcggtgtgatgcgcggcgccgtg
aagtaa

DBGET integrated database retrieval system