KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07680Help
Entry
BANAN_07680       CDS       T02047                                 

Definition
(GenBank) sugar binding protein of ABC transporter system
  KO
K10117  raffinose/stachyose/melibiose transport system substrate-binding protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni02010  ABC transporters
Module
bni_M00196  Raffinose/stachyose/melibiose transport system
Brite
KEGG Orthology (KO) [BR:bni00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BANAN_07680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bni02000]
    BANAN_07680
Transporters [BR:bni02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    BANAN_07680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_1 SBP_bac_8 SBP_bac_6
Motif
Other DBs
NCBI-ProteinID: AFI63735
Structure
PDB: 

Position
complement(1885296..1886609)
Genome map
AA seq 437 aa AA seqDB search
MDKGVRMKFATRTRRSAMRRMLRGIGAAVCALAVGVGAAGCGNSAGSGQVTLDFFQFKAE
AADWFEEAAQEFEKENPDIRININNSANAQTDLRTRFVKDRVPDVITFNGDYSFGTFAAS
GVFHDFTDDPLVNDLNEGMVNIAKNLVQTSDPAKKRLYGLPFAGNASGYIYNKDLFRKVG
LDPDDPPQTWDEFIAMLKKFRDAGINPVQATLADAWTTQAPLASLAGTLVPESEYAALKS
GDTTFKQIWTEPIEKEIELFKYADSEKGVTYQQGTQNFAKGAAAIIPLGTYAIPQITMIN
KDIDLGFAQMPATNDAGKQILTAGDDVILTMGANSRHKEQSMRFIRFLMSKKQLEDYADA
QSAITPLKETYFGNKALEPVRPFFESNRVADFCDHYIPSSINIGGYLQSAIMSGNVNQFI
DSMQNEWNKVQARDFRK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggacaagggagtcagaatgaagttcgcgacacgaacgagacgttcggccatgcgacgc
atgctccgcggcatcggcgcggcggtgtgcgccctggcggtcggcgtgggcgcggcgggc
tgcggcaacagtgccggcagcgggcaggtcacgctcgatttcttccagttcaaggcggag
gccgcggactggttcgaggaggcggcacaggagttcgagaaagagaaccccgacattcgc
atcaacatcaacaactcggcgaatgcgcagaccgacctgcgcacgcgtttcgtgaaggac
cgcgtgcccgacgtgatcaccttcaacggcgactacagcttcggcaccttcgccgcctcg
ggggtgttccacgatttcaccgatgacccgctcgtgaatgacctcaacgagggcatggtg
aacatcgcgaagaacctcgtgcagacctcggatccggcgaagaagagactgtacggtctg
ccgttcgcgggcaatgcctccggctacatctacaacaaggatctcttccgcaaggtcggt
ctcgaccccgacgatccgccgcagacatgggatgaattcattgccatgctcaagaaattc
cgtgatgcgggcatcaacccggtgcaggccacactcgccgatgcctggaccacgcaggcg
ccccttgcctcgcttgccggcacattggttcccgagagcgaatatgccgcgctgaaaagc
ggcgacaccacgttcaagcagatctggaccgaaccgatcgagaaggaaatcgaactgttc
aagtatgcggacagcgagaagggtgtcacctaccagcaaggcacgcagaacttcgccaag
ggcgcggccgcgatcattccgctcggcacctatgcgattccgcagatcacgatgatcaac
aaagacatcgacttgggcttcgcccagatgcccgccacgaacgatgcgggcaagcagatc
ctcaccgccggcgatgatgtgatcctcacaatgggcgcgaacagcaggcacaaggaacag
tcgatgcgcttcatcaggttcctgatgagcaagaagcagctcgaggactacgccgacgca
cagtccgcgatcacgccgctcaaggagacctatttcggcaacaaggcgctcgagccggtg
cgcccgttcttcgagagcaaccgtgtggcggacttctgcgaccactacattccgtcgtcc
atcaacataggcggctacctgcagtccgcgatcatgagcggcaacgtgaaccagttcatc
gactccatgcagaacgagtggaacaaggtccaggctcgtgacttccgcaagtag

DBGET integrated database retrieval system