KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07735Help
Entry
BANAN_07735       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4032 Kdo APH
Motif
Other DBs
NCBI-ProteinID: AFI63746
Position
complement(1902549..1903997)
Genome map
AA seq 482 aa AA seqDB search
MGITDNPQLDPRALKATSVKAEDPATPGSEPSTLKITAASSDPKMFTLPWEKPLATWPPE
LLVNLPRGISRHIVRFVHVGDEVYAMKEITRTVAEREYELLRQLQKLNLPTVQPIAVVTG
RHDDSGEPLEAILVTKHLRFSMPYRALFARTLRPDTAERLIDALAVLMVRLHLAGFYWGD
VSLSNVLFLKDADAFSAFLVDAETGDLQIELTSGQREYDIDLARTNIIGELMDLSSGELL
PPDVDEISIGNRLVDRYHSLWSALTDTDNFSPNEMWKIEKRVNRLNELGFDVDELEMKTA
EDGKRVLVRPRVVDAGYANRKLLRLTGLDVQENQARRLLNDLDAYRASSWRDGEDLEIVA
TDWMREVFEPTVRMIPREYRSQIEPAQFFHEVLDHRWYMAEKAGHDVPMAEAVQSYIKNV
LPQYQLDTKTVNELNADADAGVVDDEYTYDDASNNSEHTAPATAHDDGYNPEDDPDAAVW
AH
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgggaataaccgataatccgcaattggatccgcgcgcgttgaaagcgacgtcggtgaag
gccgaggatcccgcgacgccaggctccgagccatcgacgttgaagatcacagcggcgagc
tcggacccgaagatgttcacgctgccgtgggagaagccgcttgccacctggccgccggaa
ctgctggtgaatctgccgcgaggcatctcccgccatatcgtgcgcttcgtgcacgtgggc
gacgaggtgtacgcgatgaaggagatcacgcgcaccgtggccgaacgcgagtacgagttg
ctgcgccagctgcagaagctgaatctgcccactgtgcagccgatcgccgtggtcaccggc
aggcatgacgacagtggcgagccgctcgaggcgatcctggtgaccaagcacctgcgtttc
tccatgccataccgcgccctgtttgcgcgcacgctgcggcccgacaccgcggaacgcctg
attgacgcgttggccgtgctcatggtgcgtctgcatctcgcaggcttctactggggcgat
gtctcgctgtcgaacgtgctcttcctcaaggatgcagacgcattctccgcattcctcgtc
gacgccgagacgggcgatctgcagattgaactgacctccgggcagcgcgagtacgatatc
gatctggcccgtacgaacatcatcggcgaactcatggatctgagctcgggtgagctgctg
ccgccggatgtggacgagatctccataggaaaccggctcgtcgaccgctaccattcgctg
tggagcgcgctcaccgacaccgacaacttctcgccgaacgagatgtggaagatcgagaag
cgcgtgaatcgtctcaacgagcttggcttcgatgtggatgagctcgagatgaagaccgcc
gaggacggcaagcgtgtgctcgtgcgcccgcgcgttgtcgatgctggctatgcgaaccgc
aaactgctgcgcctcaccggcctcgacgtgcaggagaaccaggcccgcagactgctcaac
gacctcgacgcctaccgcgcctcgagctggcgtgacggcgaggatctcgagattgtggcg
accgactggatgcgcgaggtattcgagccgacggtgcgcatgattccacgcgaataccgt
tcgcagatcgagcccgcgcagttcttccatgaagtgctcgaccaccgctggtacatggcc
gagaaggccggccacgatgtgccgatggccgaggccgtgcaaagctacatcaagaacgtg
ctgccgcagtaccagctcgacacgaagacggtgaacgagctgaacgccgatgccgatgcc
ggtgtggtcgacgacgaatacacgtatgacgacgcctcgaacaacagtgagcacactgcg
ccggcgaccgctcatgacgacgggtacaatcccgaggacgacccggatgccgccgtatgg
gcgcactga

DBGET integrated database retrieval system