KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07745Help
Entry
BANAN_07745       CDS       T02047                                 

Definition
(GenBank) Kef-type K+ transport systems HypotheticalNAD-binding component
  KO
K10716  voltage-gated potassium channel
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
Transporters [BR:bni02000]
 Other Transporters
  Pores ion channels [TC:1]
   BANAN_07745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ion_trans_2 Ion_trans EMP24_GP25L
Motif
Other DBs
NCBI-ProteinID: AFI63748
Position
1905702..1906760
Genome map
AA seq 352 aa AA seqDB search
MTARKSARRPGLTLHTWQHYTNAPMFVLSAFFLFAYSWQILAGTHTRLCNLVINLVWVLY
GIDYAVSLYLAPNRWSWFKSNLILLITMILPMFQPLRLLRFVPMLHMFNRSAGTASRGRI
TLYAVAVVSMLIYVGALAEYSVEHKAPGATITSFPLSIWWAFVTVTTVGYGDVYPVTTLG
RFIAIILMITGIAVIGIVSAMISSWVIDQVNVARQPMPPLAHTAKTATSGDAASKGTQGA
TQSVSSSSQEVREDFDAEDYTTGDEDIIDAPDPLKEEILGPNLNTAQSKIMQAELLRLTD
SVNRLHNEIERMRRAERRHAHTSGQTTRKSKWRGDRSGHMPPHDSHEGDEPA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaagaaaaagcgcacgacggcccggtctgacactgcacacctggcagcactac
acgaacgcacccatgttcgtgctctccgcattcttcctgttcgcgtactcatggcagatt
ctcgcaggcacccacacacggctgtgcaatctggtgatcaacctggtctgggtgctctac
ggcatcgactacgccgtctcgctgtacctcgcgcccaaccggtggagctggttcaaaagc
aacctgatcctgctcatcacgatgattctgccgatgttccagccgttgcggctgctgcgc
ttcgtccccatgctgcacatgttcaaccgctcggccggcacggcctcgcgcggccgcatc
acgttgtacgcggtggccgtggtctcaatgctcatctatgtgggcgcgctcgccgaatac
tcggtggagcacaaggctcccggtgccacgattaccagtttcccgctgtcgatctggtgg
gcgtttgtcacggtgaccacggtcggctacggcgacgtctacccggtcaccacactgggc
agattcatcgcgatcattctcatgatcaccggcatcgccgtcatcggcatcgtgagcgcc
atgatctcgtcgtgggtgatcgaccaggtcaacgtggcccgccagcccatgccgccattg
gcgcacaccgcgaaaaccgccacttcgggcgacgctgcttccaaggggacgcagggtgcg
acgcaatccgtctcgagcagttcacaggaggttcgcgaagacttcgacgccgaggactac
accactggcgatgaggacatcatcgacgcacccgatccgctcaaggaggagattctcggg
ccgaatctgaacaccgcacagtcgaagatcatgcaagcggaactgctgcggctcaccgat
tcggtgaatcgtctgcacaacgagatcgagcgcatgcggcgtgcggaacgcaggcatgcg
cacacctccgggcaaaccacacgcaaatcgaaatggcgcggggatcgcagcgggcacatg
ccgccccacgactcccatgagggcgacgaaccggcctga

DBGET integrated database retrieval system