KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07760Help
Entry
BANAN_07760       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G5 DUF348 PT
Motif
Other DBs
NCBI-ProteinID: AFI63751
Position
1910964..1912511
Genome map
AA seq 515 aa AA seqDB search
MARRWTPQRMMRLRTIRIASSMVTIVALLLGFFVCARKTVALEVNGETTTVTTFATTIPG
FLREQHVKLKTHDLVRSSTPGQLTDNSTVTVQSAYQTTISIDGQQMPFWTVADSAEQLIA
FFEQNEVAANRITVDIKNVYNQLTGGLVINADGPVTVIADGKTSIAPNGKLPAASIIDSK
GITLGKNDRVSVSKDGSQTILRVERVTTKEITETEDVPFSTQTIVDDSLEPGVTEVRQEG
RNGQNQLRYRVTYVDGKEDSRELLDTTPLSTPIDRIIAIGPEPVKETPQKEDNPGASNDE
VQSAGQSAGNSAGTNDKQSATENNTGDAAEPSAESSPTPSAQPSQQPSAKPSEQPTSKPT
QSAQPTQKPSEQPTQQPSAQPTQQPKPTPTPTQKPTQQPEQPTPSNCRLCKPSPSAAQAY
AAGAAAQYGWTGKNWEDLVKLWNRESNWLWYAENKSSDAYGIPQSLPGSKMAQFGENWKE
DAAVQIDWGLNYIATHPKYGSPSKAWAHSEKYGWY
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcgagacgttggactccgcagcgcatgatgcgattgcggaccattcgcattgcgtcg
agtatggtcaccattgtggccctgctgctcggtttcttcgtgtgcgcacgaaaaaccgtg
gcgctcgaggtgaacggcgaaaccaccaccgtcaccacgttcgcgaccacgattcccggg
tttctacgcgaacagcatgtcaagctcaaaactcacgatctggtgcgctcctccactccg
ggccagctcaccgacaactccaccgtcaccgtgcagagcgcctaccagacaaccatctca
atcgacggccagcagatgccgttctggacggtcgccgacagcgcggaacagctcatcgcc
ttcttcgaacagaacgaagtggccgcgaaccgcatcaccgtggacatcaagaacgtgtat
aaccagctcaccggcggactggtgatcaacgccgacggtccggtcaccgtgatcgcggac
ggcaagacctccattgcccccaacggcaagctccccgccgcctccataatcgattcgaaa
ggcatcacgctgggcaagaacgaccgcgtgagcgtttcgaaagacggctcgcagactatt
ctgcgcgtggagcgcgtgaccaccaaggagatcaccgaaaccgaggatgttccgttctcc
acgcagacgattgtggacgactcgcttgaacccggggtcaccgaggtacggcaggagggc
aggaacgggcagaatcagctgcgctaccgcgtgacctacgtagacggcaaggaggactcc
cgcgaactgttggacaccaccccactgtccaccccaatcgaccggatcatcgccataggg
cctgaacccgtgaaagagacgccccagaaggaagacaaccccggcgcgtccaacgacgaa
gtgcaatccgcaggccaatctgcaggcaattccgcgggtacgaacgacaagcagtccgca
acggaaaacaacaccggagacgccgcggaaccaagtgctgaatcctcccccaccccctcg
gcacaaccgagccagcagcccagcgcgaagccgagcgagcaaccgacgagcaagccgacg
caatccgcacagcccacacagaaaccgtctgagcagcctacgcagcaaccgtccgcgcag
cccacccaacagccgaagcccacgccgacacctacccaaaagccgacgcagcaaccggaa
cagcccacgccatcgaattgccgcctgtgcaagccgagtccgagcgccgcgcaagcgtat
gcggccggcgccgcagcacaatacgggtggaccggcaagaactgggaagatctggtgaag
ctgtggaaccgcgaatcaaactggctgtggtatgcggagaacaagtcgtcggacgcatac
ggcataccgcaatccctgccgggcagcaaaatggcgcagttcggcgagaactggaaggaa
gacgccgccgtgcagattgactggggactcaactacatcgccacgcatccgaagtacggc
agtccgagcaaggcgtgggcccactccgagaaatacgggtggtattaa

DBGET integrated database retrieval system