KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07780Help
Entry
BANAN_07780       CDS       T02047                                 

Definition
(GenBank) RNA nucleotidyltransferase
  KO
K00970  poly(A) polymerase [EC:2.7.7.19]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bni00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BANAN_07780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bni03019]
    BANAN_07780
Enzymes [BR:bni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     BANAN_07780
Messenger RNA biogenesis [BR:bni03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     BANAN_07780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PolyA_pol PolyA_pol_RNAbd HD tRNA_NucTran2_2
Motif
Other DBs
NCBI-ProteinID: AFI63755
Position
complement(1915393..1916811)
Genome map
AA seq 472 aa AA seqDB search
MNFEVWPEAIELGQMFADEGFELALVGGPVRDLLLHRRSHDLDFCTNARPEQFEPILRRF
GHDGFWDMGRKFGTLGAMRRRPDGTEVKVEVTTYRSDVYDPDSRKPEVSYGDSLDGDLSR
RDFTVNAMALTVPDLEFVDPFGGANDLNKRVLRTPVDPYQSFDDDPLRMMRAVRFVAQLG
FSIEPETAEAITRMTDRIEIVSAERVRDELTKLLLSDRPRAGIEALVDSGLADVVLPEIP
ALRLEIDEHHRHKDVFDHTMIVVDRAVALETGPDGPVPAPDLVLRLAALMHDIGKPKTRR
FEPRGKVSFHHHDAVGAKMTRKRLRALRFDHHVVEQVSDLVDLHLRFHGYVDEPWTDAAV
RRYVKDAGPLYARLNRLTRADATTQNRRKALMFEHAMDEMEERVAKLKEQEDIDAIRPDL
NGDEIMAELGIAPGPLVGKAYRHMLEYRLDNGPVDHDTAVAELHNWYASQAE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttcgaggtgtggcctgaggcgattgagctggggcagatgttcgcagatgaaggc
tttgaactggcgctggtgggcggcccggtgcgtgacctgctgctgcaccggcgctcgcat
gacctcgatttctgcacgaatgcgcgtccggagcagttcgagccgattctgcggcgcttt
ggacacgatggcttctgggacatgggccgtaagttcggcacactcggtgcgatgcgccgg
cggccggatggcaccgaggtcaaggtggaggtgaccacctaccgctccgacgtgtacgac
ccggattcgcgcaagccggaggtgagctacggcgattcgctcgacggagatctctcccgc
cgtgatttcacggtgaatgcaatggcactcactgtgcccgaccttgaattcgtagacccg
ttcggcggggcgaacgacctcaacaagcgggtgctgcgcacgccggtggacccatatcag
agcttcgacgacgacccgttgcgcatgatgcgggcggttcgcttcgttgcgcagctcggc
ttctcgattgaacccgagaccgccgaggcgattacgcgcatgaccgaccgcattgagatc
gtctccgcggaacgtgtgcgtgacgagctgacgaagctgctgctctccgaccgcccgcgt
gccggcattgaggcattggtggattcgggtcttgccgatgtcgtattgcccgagattccc
gctctgcgcttggagattgacgaacaccaccgccacaaggatgtgttcgaccacacgatg
atcgtagtcgaccgcgcggtggcattggagaccggcccggatggcccggtgccggccccg
gacttggtgctgcgcttggcggccctgatgcatgacattggcaagccgaagactcgcaga
ttcgagccgagaggcaaagtgagcttccaccaccacgatgcggtgggtgccaagatgacg
cgcaaacggctcagggcgctgcgcttcgaccatcatgtggtggagcaggtgagtgacttg
gtcgaccttcacctgcgcttccatggctacgtggacgaaccgtggaccgatgccgccgtg
cgtcgctacgtcaaggacgcgggcccgctctacgcccgtctcaatcggctgacgcgtgcc
gatgccaccacgcagaaccgacgcaaggcgctcatgttcgagcatgcgatggatgagatg
gaggaacgggtcgccaagctcaaggagcaggaggacatcgatgcgattcgccccgatctc
aacggcgacgagatcatggccgaactcggcatcgcccccgggccgttggtgggcaaggcg
taccgacacatgcttgaatatcgtctcgacaacggccccgtcgatcacgacaccgctgtg
gctgagctccacaactggtatgcctcgcaagccgagtag

DBGET integrated database retrieval system