KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07790Help
Entry
BANAN_07790       CDS       T02047                                 

Definition
(GenBank) hypothetical protein
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF202
Motif
Other DBs
NCBI-ProteinID: AFI63757
Position
1918004..1920253
Genome map
AA seq 749 aa AA seqDB search
MNPHRTDLRHTARQRCKGTALLTVLFTLILALCTGFAVRPAHAEEPDTTTNTDQAAKPGV
SITVNSMTPVITPSSGYKLNLTVMNNTDADVDHGSIDALTNFTYNFISRTDLQEWAEGRG
QIPLPDLLVTLHVPRIAAHKSVTVNSSLPASEQILKQFNSWGPRPLALDYRSDDGAQTST
LHSFVTRSQDGLQGERTPQLHMTMLMPLTAGDWSLDETTLKALRADRSAKTHASAIAALD
SKSTEALRAKDQLMQRFPHVQTLADPQVLATLQTPHTQALMQPADFDITRYSYAGNANGY
VNAGVPLSSWASSNSVQTLRTVLNDGTAERPVYAMQGVGAWNTEALDTARMQGYDTVIAT
HDFDDQDDTAAHTGVYRVPTAHGDVTVMATHPMLSQLAAGQATSQQAQAETNTAGRLQRF
IAQSAFYQMEQPYQNRCLLVSFGPDSSAANVSTFMGALQEASWLDLTDLETLRASEPYMS
GDDAAAVADTTTVDPAVYDTATLNTTLTTLAHTRRDLQHFNTSVLLADGSMPGDSAAQAG
DANNTKPGNGDANDTGDANDNATSDDSGDALGALQWSNRWLQAHDELALLSLNANTARSS
ALTVATQAMVDYLRQGIGLTNPTNVNVVSESASLPVTVTNSLPYPISLRISSRTDSMEIV
TSRFVDVNVPPDSEAPATLEIRVSTSGTTVANQELVNHEGVPLSGIHTTTITSSLQISDK
SGIVFIIIAVLLGIVGLWRQFHRKKDPDE
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccacaccgcaccgacctgcgccacacggcacgacagcggtgcaagggcaccgcg
ctgctcacggtgctgttcacgctcatactggcattgtgcaccggcttcgcagtccgaccg
gcacatgccgaggaacccgacaccacgacgaataccgaccaggccgccaaacccggcgta
tcaatcacggtcaactcgatgacgccggtgatcacgccatcctccggctacaaactgaat
ctgaccgtcatgaacaacaccgacgcggatgtggaccacggctccatagacgcactcacg
aacttcacctacaatttcatctcccgcaccgacctgcaagaatgggccgaaggccgaggg
cagattccgttgcccgacctgcttgtcaccctgcacgtgccgcgcatcgccgcacacaaa
tcggtgaccgtgaacagttcgctgcctgcgagcgagcagattctcaaacagttcaattcg
tggggtccgcgcccgctcgcactcgactaccgcagcgatgacggcgcgcagacgagcacg
ctgcacagtttcgtcacgcgctcgcaggatggcttgcagggcgagcgcacaccgcagctc
catatgacgatgctgatgccgctcactgccggcgactggtcgctcgacgagaccacactc
aaggcgctgcgggcggatcgctcggcgaagacgcatgcctccgccatcgcagccttggac
agcaagagtaccgaggcactgcgcgccaaggaccagctcatgcagcgcttcccccatgtg
cagacgctcgcggatccgcaggtgctcgccacgctgcagacccctcacacgcaggcgctc
atgcaacccgccgatttcgacattactcgctacagctatgccggcaatgcgaacggatat
gtgaatgccggcgtcccgttatcgagctgggcctcctccaattcggtgcagacgctgcgc
accgtgctcaacgacggcactgccgagcgccctgtctatgcgatgcagggtgtgggggct
tggaacaccgaggccctcgatacggcgcgcatgcaggggtatgacacggtgatcgccacc
catgacttcgatgatcaggatgacacggcagcccacaccggcgtctatcgcgtgcccacc
gcccacggcgacgtcacggtgatggccacgcatcccatgctctcgcagctggcggcgggc
caagccacgtcgcagcaggcgcaggcggagacgaacaccgccggccggctgcagaggttc
atcgcccagagcgccttctaccaaatggaacagccgtaccagaaccgttgcctgctggtg
agtttcggcccggattcctctgccgcgaacgtctccaccttcatgggggcgctgcaggag
gcgagttggctcgatctcaccgatctggagacgctccgtgccagcgagccgtacatgagc
ggcgatgacgcggcggccgtggccgacaccaccaccgtcgacccggctgtatatgacacg
gcaacgcttaacacgaccttgaccaccttggcacacacacgccgtgacctccagcacttc
aacacctccgtgctgctcgccgatggcagtatgccgggcgactccgcggcacaggcgggc
gatgccaacaacaccaagcccggcaacggcgatgccaacgataccggtgatgccaacgac
aatgccacgtcagacgattccggtgatgcgttgggcgccctccaatggagcaaccgctgg
ctgcaggcccacgatgagctcgcgctgctgtcactcaatgcgaacaccgcacgttccagc
gcgctcacggtcgccacacaggccatggtcgactatctgcgccaaggcatcggccttacc
aaccccaccaatgtgaacgtcgtctccgaatcggcctcgctgccggtgaccgtgacgaac
agcctgccctacccgatctcactgcgcatctcgtcgcgcaccgattcaatggagatcgtc
acctcccgtttcgtcgacgtgaatgtgccgccggacagcgaagcgccggccacgctggag
attcgcgtctccacctcgggcaccacggtggccaatcaggagctcgtgaatcatgaaggc
gtgccgctcagcggcatccacaccaccacgatcacctcgtcgctgcagatcagcgacaaa
agcggcatcgtgttcatcatcatcgcggtgctgctgggcattgtaggcctgtggcgccaa
ttccatcgcaagaaggaccccgacgaatga

DBGET integrated database retrieval system