KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07800Help
Entry
BANAN_07800       CDS       T02047                                 

Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:bni00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BANAN_07800
Enzymes [BR:bni01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BANAN_07800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 FAD_binding_2 GIDA NAD_binding_7 FAD_binding_3 Thi4 FAD_oxidored K_oxygenase DAO NAD_binding_8 Trp_halogenase HI0933_like PALP XdhC_C Mqo UPF0227
Motif
Other DBs
NCBI-ProteinID: AFI63759
Position
1924516..1925478
Genome map
AA seq 320 aa AA seqDB search
MNSTAAVRNVIIVGSGPAGYTAAIYLARAGLKPVVVAGALTPGGQLINTTEVENYPGFPD
GVMGPDLMESMQRQAERFGAEIIFDDVESVDLQGELKSVRLSGGQDLQTRALIVATGSNY
RHLDVPGELEYSGKGVSYCATCDGFFFRGKPIVVVGGGDSAMEEANFLARFGSSVTLIHR
RDEFRASQIMVERTRENPKINLLMSTVVERINGDSKGVTSLDLRNTATNETSKIEANGVF
VAIGHVPQTGFLGGQVDLDEHGYIQIAETSTGATRTSVPGVFAAGDCADAIYQQAIVAAG
SGCRAALDVQSYLEDIPEGI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcacagcagcagtacgtaacgtcatcattgtcggatcgggccccgccggttat
acggccgcgatctatctggcccgcgctggactcaagcccgtcgtcgtcgcaggggcgctc
accccgggcggccagctcatcaacaccacggaggtcgagaactaccccggcttccccgat
ggcgtgatgggccccgacctcatggaaagcatgcagcgacaggccgaacgcttcggtgcc
gagatcatattcgacgacgtggaatcggtggatctgcaaggcgagctcaaatccgtgcgt
ctgagtggcggccaggatctccagacgcgcgcgctcattgtggcgaccggttcaaattac
cggcatctcgatgtgcccggcgaactcgaatattctggcaagggcgtctcgtattgtgcg
acgtgcgacggcttcttcttccgtggcaagccgatcgtcgtagtgggcggcggcgattcc
gcaatggaggaggcgaacttcctcgcgcgcttcggctcgtcggtcacgctgatccaccgc
cgcgacgagttccgcgcctcgcagatcatggtggaacgcacacgggagaatccgaagatc
aatctgctcatgagcaccgtcgtcgaacgcatcaacggcgatagcaagggggtcacctcg
ctcgacctgcgcaacacggcgaccaacgagacttcgaagatcgaggcaaacggcgtattc
gtggcgattggccatgtgccgcagaccggtttcctcggaggccaggtcgacctcgacgag
cacggctatatccagatcgccgaaacctccaccggcgccacccgcacgagcgttccgggc
gtattcgcggccggagactgcgcggacgccatctaccagcaggccattgtcgccgctggt
tcgggctgccgcgccgcccttgacgtccaaagctacctggaagacattcccgagggcatc
tag

DBGET integrated database retrieval system