KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07835Help
Entry
BANAN_07835       CDS       T02047                                 

Definition
(GenBank) ribonuclease P protein component
  KO
K03536  ribonuclease P protein component [EC:3.1.26.5]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Brite
KEGG Orthology (KO) [BR:bni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bni03016]
    BANAN_07835
Enzymes [BR:bni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     BANAN_07835
Transfer RNA biogenesis [BR:bni03016]
 Prokaryotic Type
  5'processing factors
   Ribonucrease P
    BANAN_07835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease_P
Motif
Other DBs
NCBI-ProteinID: AFI63766
Position
complement(1931976..1932332)
Genome map
AA seq 118 aa AA seqDB search
MERLKNHREFVAVLKRRRRVSDADIVLHYVVHTPSTPTGAAPARRLGLAVSKSVGNAVVR
NTVKRRFRVLAHRYEHELPADCDIVLRAKPRAAHASFQSLEAQIQALFRAVMRKSEQS
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
gtggagcggctgaaaaaccatcgcgaatttgtcgccgtactcaaacgccgccgtcgggtc
agtgacgcggacattgtgctgcattacgtggtgcacacgccgtcgaccccgaccggtgcg
gcaccggcgaggcgtttgggtttggccgtctccaaatcggtggggaacgcggtggttcgc
aatacggtgaaacgtcgattccgagtattggcgcatcgctatgagcatgagcttcccgca
gactgcgatattgtgctgcgtgcgaagccgagggcggcgcatgcctccttccagtctctt
gaagcgcagattcaggcgctgtttcgcgcagtgatgcgcaaatcggagcaatcgtga

DBGET integrated database retrieval system