KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_07840Help
Entry
BANAN_07840       CDS       T02047                                 

Gene name
rpmH
Definition
(GenBank) 50S ribosomal protein L34
  KO
K02914  large subunit ribosomal protein L34
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni03010  Ribosome
Module
bni_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bni00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BANAN_07840 (rpmH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bni03011]
    BANAN_07840 (rpmH)
Ribosome [BR:bni03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BANAN_07840 (rpmH)
  Bacteria
    BANAN_07840 (rpmH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L34
Motif
Other DBs
NCBI-ProteinID: AFI63767
Position
complement(1932345..1932479)
Genome map
AA seq 44 aa AA seqDB search
MKRTFQPNNRRRHMKSGFRVRMRTRAGRALINRRRAKGRKSLSA
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggacattccagccgaataaccgccgccgtcacatgaagagcggcttccgcgtt
cgcatgcgcacccgcgcaggccgcgcgctcatcaaccgccgtcgcgccaagggccgcaag
tccctctccgcctga

DBGET integrated database retrieval system