KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00212Help
Entry
BALAC2494_00212   CDS       T01842                                 

Definition
(GenBank) Phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
bnm00030  Pentose phosphate pathway
bnm00480  Glutathione metabolism
bnm01100  Metabolic pathways
bnm01110  Biosynthesis of secondary metabolites
bnm01120  Microbial metabolism in diverse environments
bnm01130  Biosynthesis of antibiotics
bnm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bnm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BALAC2494_00212
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BALAC2494_00212
Enzymes [BR:bnm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BALAC2494_00212
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BALAC2494_00212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored Shikimate_DH ApbA 3HCDH_N 2-Hacid_dh_C AlaDh_PNT_C adh_short
Motif
Other DBs
NCBI-ProteinID: AEK30491
Position
complement(1188736..1190427)
Genome map
AA seq 563 aa AA seqDB search
MSAPANVGVVGLAAMGASLARNLARHGNAVAIYNRHYSRTEKLMEEYGDEGAFYPAKTVK
EFVDLLERPRTAIIMVKAGSATDAVINELAEYMEPGDIIVDGGNAYFKDTIRRERELRAK
GLHFVGMGVSGGEEGALLGPSMMPGGSDESWERLKPILESIAAKATDGEPCVMHVGENGA
GHFVKMVHNGIEYADMQLIAESYDIMRRGLNMTPDEIGGVFESWNKTDLDSYLIEITAEV
LHKKDPRTGKPLVDVIVDHAGMKGTGTWTVQTALELGVPVTGIAEAVFARGLSDQNVLRE
MAQQNPFAGPDGHIDLGDLSREEFIGQIRNALYASKIIAYAQGFNEISVAARTYGWNIDM
AHLARIWRAGCIIRAQFLDRISEAFESGQADVSLLFAPYFKSGIEHSEADWRSVVATSAK
SGLPAPVFSSSLAYFDGLRAKRLPAALTQGQRDLFGAHTYGRVDMPGAYHILWATPEQNE
VKISDWSQGPRRPVPIPQAVRISAVPAGRLVSDPKHLLHSIRIGGGKGRIVLGVERQSHR
LGLALTGAAHPYVIRPHDHRHRQ
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaccggcaaatgtgggtgtcgtgggacttgctgccatgggggcgagcctggct
cgtaatctggcccgtcatggcaatgccgtggccatctacaaccggcattattcccgtacc
gagaagctcatggaggagtatggcgacgagggcgcgttctacccggcgaagaccgtcaag
gagttcgtcgatctgctcgaacgtccccgcaccgccatcatcatggtcaaggcaggatcg
gccaccgatgcggtgatcaacgagcttgccgaatatatggagcctggcgacatcatcgtc
gacggtggcaatgcctatttcaaagacaccattcgccgtgagagggaactgcgcgccaag
ggtcttcatttcgtgggcatgggtgtctccggcggcgaggaaggcgcattgcttggacca
tcgatgatgccgggtggcagcgatgagtcgtgggagcgtctcaagccgattctcgaatcg
attgcggccaaggcaacggatggcgagccgtgtgtcatgcatgtgggggaaaacggggcc
ggccatttcgtcaagatggtgcacaacggcatcgaatacgccgacatgcagctcatcgcc
gaaagctacgacatcatgcgccgtggcctgaacatgacgcccgatgagatcggcggcgtg
ttcgaaagctggaacaagaccgacctcgactcctacctcatcgagatcaccgccgaggtg
ctgcacaagaaggatccgcgcaccggaaagccgttggtcgatgtgatcgtcgaccatgca
ggcatgaaaggcaccggaacctggacggtgcagaccgcccttgaactcggtgttccggtc
accggcatcgccgaggccgtgttcgcacgcgggctctccgaccagaacgtactgcgcgag
atggcacagcagaatccgtttgcaggtcccgacggccatatcgatctcggcgatctgagc
cgcgaggagttcatcgggcagatccgtaacgcactctatgcttcgaagatcattgcctat
gcgcagggcttcaatgagatcagcgtcgcggcacggacctatggatggaacattgacatg
gcgcatctggcacgcatctggcgcgccggctgcattattcgtgcgcagttccttgatcgc
atctccgaggccttcgaatccgggcaggccgatgtctcgctgttgttcgccccgtatttc
aagagcggcatagagcacagcgaggcggattggcgcagcgttgtggccacctcagccaag
tccggcctgccggcgccggtgttctcgtcatcgctcgcgtatttcgacggcctgcgtgcc
aagaggcttccagccgcgctcacgcaaggccagcgtgatctgttcggtgcacacacctat
ggccgtgtcgatatgccgggtgcctaccacatcctgtgggctacgcctgagcagaatgaa
gtcaagatctccgactggagtcaggggccgcgccgccccgttcccataccacaagccgtg
cggatatcagcagtcccggccggccgcctcgtcagtgatccaaagcacctgctgcacagc
atccgcataggaggcgggaagggcaggattgttctgggcgtggaacgtcaatcccatcgc
ctcggccttgccctcacgggagccgcacacccatacgtaatccgtcctcacgatcatcgg
caccgtcaatga

DBGET integrated database retrieval system