KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00215Help
Entry
BALAC2494_00215   CDS       T01842                                 

Definition
(GenBank) Glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
bnm00030  Pentose phosphate pathway
bnm00480  Glutathione metabolism
bnm01100  Metabolic pathways
bnm01110  Biosynthesis of secondary metabolites
bnm01120  Microbial metabolism in diverse environments
bnm01130  Biosynthesis of antibiotics
bnm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bnm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BALAC2494_00215
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BALAC2494_00215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bnm04147]
    BALAC2494_00215
Enzymes [BR:bnm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BALAC2494_00215
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BALAC2494_00215
Exosome [BR:bnm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BALAC2494_00215
  Exosomal proteins of colorectal cancer cells
   BALAC2494_00215
  Exosomal proteins of bladder cancer cells
   BALAC2494_00215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AEK30488
Position
1185535..1187103
Genome map
AA seq 522 aa AA seqDB search
MNTMTEHTTHTPGDSPWVNPLRDPRDLRLPRIAGPCSIVIFGVTGDLARKKLLPAIYDLA
NRGLLPPSFGLTGFARRDWTEDHFRQFVKENVQQHCRTHFNEVTWNQLAEGIRFVHGTFE
DADAFERLSNTVAELDKDRGTRGNHAFYMSIPPRDFPLVAQQLANCGLAKSNGDAWRRVI
IEKPFGHDLASAKELDRVISEVFDPNSVFRIDHYLGKETVQNLLALRFANSMYEPIWNSN
YVDHVQITMAEDIGVAGRAGYYDGIGAARDVIQNHLLQLLALTAMEEPVSFNARDLTDEK
TKILSAVRLPKDLAAHTARGQYSAGWQGSRPVVGYLEEKGINPDSTTETYAAVRLDIDTR
RWAGVPFYLRTGKRLGRRVTEIALVFKRAPHLPFDSTATQELGKNAIVIRIQPYEGVTIR
FGSKVPGGTTMEVRDVSMDFSYGRSFTESSPEAYERLILDVLLGDPPLFPTTQEVDLSWK
ILDPIEDFWSTLGQPQPYRAGTWGPQEAVEMLARDGHRWRMP
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaacactatgactgaacacacaacgcacactcccggggactcgccctgggtcaatccg
ttgcgcgacccacgagatctgaggcttccccgcatcgccgggccatgttcgatcgtgatc
ttcggcgtcacgggcgatctggctcgcaagaaactgttgccggcgatctacgatctcgcg
aaccggggcttgctgccaccgagcttcggtctcaccggtttcgcacggcgtgattggacg
gaggatcatttccgtcaatttgtcaaggaaaatgtgcagcagcattgccgcacgcatttc
aacgaggtcacctggaaccagcttgcagagggcatacgtttcgtgcatggcaccttcgag
gatgccgatgcattcgagcgcctgagcaatacggtggccgaactcgacaaggaccgtggc
acacgcggcaaccatgccttctacatgtcgattccgccccgtgacttcccgctcgtggcg
cagcagctcgccaactgcggtctggccaaatcgaacggcgacgcctggaggcgcgtgatc
atcgaaaagccgttcgggcacgatctggccagcgccaaggagctcgaccgcgtgatctcc
gaggtgttcgacccgaactcggtattccgcatcgaccactacctgggcaaggagaccgtg
cagaatctgctggcgttgcgcttcgccaactccatgtacgagccgatatggaattcgaac
tatgtggaccatgtgcagatcacgatggccgaagacattggcgtggcggggcgagccggt
tactacgacggcattggtgcggcacgcgatgtgatccagaaccatctgctgcagttgctc
gcattgacggccatggaggaaccggtttcgttcaatgcgcgtgatctgaccgatgagaag
acgaagattctctcggccgtacgcctgccgaaagaccttgccgcgcataccgctcgcgga
cagtattcagcaggctggcagggctcccgtccggttgtggggtatctggaggagaagggc
atcaacccggattccaccactgaaacctatgcggccgtcagactcgatatcgacacgcgt
cgctgggctggcgtcccgttctacctgcgtaccggcaagcgccttggccgccgcgtgacc
gaaattgcgctggtgttcaagcgcgccccgcatctgccctttgacagcaccgcgacacag
gaactcggcaagaacgccatcgtcattcgcatccagccctatgagggcgtcaccattcgt
ttcggatccaaggtccccggaggcaccaccatggaggtgcgcgacgtctcgatggacttc
agctacggccgttcgttcaccgaatcgtcacccgaggcttacgagcgcctcatcctcgac
gtgctgctgggagatccgccgttgttcccgaccacacaggaagtggacctgtcgtggaag
atcctcgaccccatcgaggatttctggtccacgctcggccaaccacaaccatatcgtgcc
ggcacatgggggccccaggaggcggtggagatgcttgcccgtgatggacaccgttggagg
atgccatga

DBGET integrated database retrieval system