KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00836Help
Entry
BALAC2494_00836   CDS       T01842                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase (GDP)
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
bnm00051  Fructose and mannose metabolism
bnm00520  Amino sugar and nucleotide sugar metabolism
bnm01100  Metabolic pathways
bnm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bnm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BALAC2494_00836
   00520 Amino sugar and nucleotide sugar metabolism
    BALAC2494_00836
Enzymes [BR:bnm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BALAC2494_00836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEK29749
Position
357309..358520
Genome map
AA seq 403 aa AA seqDB search
MSNGFDDFYAIIPAGGTGTRLWPLSREAKPKFLFDLLGSGRTLIQSTFDRLAAIAGMDHV
CISTGERHVDAVEEQMPEVAPEHIFAEPAPRDSTAAIALATAVLARRHGNDIVVGSFAAD
HVIRGKVAFVDAVRQAVATARAGYVTTIGIAASRPSTAFGYIHEGESLAARVPDAPDAVL
VERFVEKPNAATAQAYLNTGEYRWNAGMFVMRADVLLDHLHRVKPQLARAIDAIADAVIE
DDRDLARAQAEAHERGENVRETVNPDDFHAHRDEAMRKYWQGIEKIAFDYAVAEPLSVEG
GVAMIPGDFGWDDIGDFNSVAALLPSVDERNLKILGNTEQVVTLDSAGDIVVPNSERTVA
LLGVNDMVVVDTPDALLITPRARSQEVKSMVKTLAESGCDELL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacggattcgacgatttctacgccatcattcccgcgggcggcaccgggacgcgc
ctgtggccgctgagccgcgaggccaaaccgaagttcctgttcgacctgctcgggtcgggg
cgcacgctgattcagtccaccttcgaccgcctcgccgccatcgccggcatggaccatgtg
tgcatcagcaccggcgaacggcatgtggacgccgtggaggagcagatgcccgaggtggcg
ccggaacacatcttcgccgaaccggcaccgcgtgattccacggccgccattgcgctcgcc
accgccgtgctcgcccgcaggcacggcaacgacattgtggtcggatcgttcgccgccgac
catgtgatccgcggcaaggtggcgttcgtcgacgccgtgcggcaggccgtcgccaccgcc
cgcgccggctatgtgaccaccatcggcatagcagcctcgcgcccgagcaccgcattcggc
tacatccacgaaggcgagtcgctcgcggcccgcgttcccgacgccccggacgccgtgctc
gtggaacgcttcgtggagaagccgaacgccgccaccgcgcaggcctacctgaacaccggc
gaataccgctggaacgccggcatgttcgtgatgcgcgccgatgtgctgctcgaccacctg
caccgggtcaagccacagctcgcacgcgcgatcgatgcgatagcagacgccgtgatcgaa
gacgatcgcgatctcgcccgcgcgcaggccgaggcacatgagcgcggcgagaacgtgcgc
gagaccgtgaatcccgacgacttccacgcccaccgcgacgaggccatgcgcaagtactgg
cagggaatcgagaagatcgcgttcgactacgcagtggccgagccgctatcggtggagggc
ggcgtcgcgatgatcccgggcgacttcggctgggatgacattggtgatttcaactcggtg
gcggcactgttgccgagcgtggacgagcggaatctgaaaatactgggcaacaccgagcag
gtggtcacactcgactccgccggcgacatcgtggtgccgaacagcgaacgaaccgttgcg
ttgcttggcgtgaacgacatggtcgtggtggatacgccggatgcattgctcatcacgcca
cgtgcgcggagccaggaagtcaagtcaatggtgaaaacgctcgcggagtcggggtgcgac
gaactactgtga

DBGET integrated database retrieval system