KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_01321Help
Entry
BALAC2494_01321   CDS       T01842                                 

Definition
(GenBank) Arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
bnm00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bnm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BALAC2494_01321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bnm01007]
    BALAC2494_01321
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bnm03016]
    BALAC2494_01321
   03029 Mitochondrial biogenesis [BR:bnm03029]
    BALAC2494_01321
Enzymes [BR:bnm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     BALAC2494_01321
Amino acid related enzymes [BR:bnm01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BALAC2494_01321
Transfer RNA biogenesis [BR:bnm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BALAC2494_01321
 Prokaryotic type
   Other AARSs
    BALAC2494_01321
Mitochondrial biogenesis [BR:bnm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BALAC2494_01321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AEK30885
Position
complement(1670075..1671871)
Genome map
AA seq 598 aa AA seqDB search
MSPEALQELIFTIANNLVSEGKAGTLTAEELPDSAKFAVMRPKDRAHGDWASNAAMQLAK
KAGMKPRDLAQLFADALNGTDGIAAVEVAGPGFINITLDSASAAAVVDQVLDEGNRFGKN
NHLSGKTLNLEFVSANPTGPIHIGGTRWAAVGDSMARILQANGATVVREYYFNDHGEQIN
RFAKSLVAAAHDEPTPVDGYKGAYIDEIARRVIVEANAEGIDILNLPRVDGGTDEKGEPL
GEGDSEQREEFRKRAVPMMFDEIRQSMKEFRVHFDVWFHENSLYEDGEVEKAIADLRNAG
DIYEKDGATWFESTEHGDDKDRVIIKSDGTYAYFAADIAYYRNKRHRKTDPADVAIYMLG
ADHHGYIGRMMAMCAAFGDKPGENMQILIGQMVNVMKDGKPVRMSKRAGNIVTIDDLIDA
IGVDASRYSLARTDYNSPVDIDLNLLASHSNDNPVYYVQYAHARSCNVDRNAEAAQINAA
DADLSLLDTEADGEVIAALAQWPALLTLAGDLRAPHRIAHYLEDLAAAYHKWYNVERVVP
MPLTEAEERADEQTRERTRIAKNPEPARAAARLKLNDAVQTVIAEGLDLLGVTAPDKM
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgagtccagaagcgctacaggaattgatcttcaccattgccaataaccttgtttccgag
ggtaaagccggcactttgacggccgaggaactcccggattccgccaaattcgccgtcatg
cgccccaaggatcgcgcgcacggcgactgggcgtcgaacgccgccatgcagctggcgaag
aaagccggcatgaaaccgcgtgatctcgcccaactgttcgccgacgcactgaatggcacc
gatggcattgccgccgtcgaagtggcaggtcccggcttcatcaacatcacgctcgactcc
gcatcggcggccgcagtggtggaccaggtgctcgacgagggcaatcgattcggcaagaac
aatcacctgagcggcaagacgctcaatctggaattcgtctccgcgaacccgaccggcccg
atccacatcggcggcacgcgctgggccgcggtgggcgattcgatggcccgcatactgcag
gccaatggcgccaccgttgtgcgcgaatactacttcaatgaccacggcgagcagatcaac
cgcttcgccaagtcgctcgtggccgccgcccacgacgagccgacgcccgtcgacggatac
aagggcgcctacatcgacgagatcgcacgccgtgtgatcgtggaggccaacgccgaaggc
atcgatattctcaatctgccgcgcgtcgacggcggcaccgacgagaagggcgagccgctg
ggcgaaggcgattccgagcagcgtgaggagttccgcaagcgcgcggtgccaatgatgttc
gacgagattcgccagtccatgaaggaattccgcgtgcacttcgatgtgtggttccacgag
aacagcctgtacgaggacggcgaggtggagaaggcgatcgccgacctgcgcaatgccggc
gacatctacgagaaagacggcgcgacctggttcgaatcgaccgagcatggcgacgacaaa
gaccgcgtgatcatcaaatccgacggcacgtacgcatacttcgccgcggacatcgcctac
taccgcaacaagcgccaccgcaagaccgacccggccgacgtcgcgatctacatgctcggc
gccgaccaccacgggtacatcggccgcatgatggccatgtgcgccgcgttcggagacaaa
ccgggcgagaacatgcagattctcatcggccagatggtcaatgtgatgaaggacggcaag
ccggtgcgcatgagcaagcgcgcgggcaacatcgtgacgatcgacgacctcatcgacgcg
attggcgtggacgcatcccgctattcactggcccgcaccgactacaattcgccggtcgac
atcgacctcaatctgctcgcctcgcattcgaacgacaatccggtgtactatgtgcagtat
gcgcacgcccgctcgtgcaacgtcgaccgcaatgccgaagccgcgcaaatcaatgccgcc
gacgccgatctctcgctgctcgacactgaggcggacggcgaggtgatcgccgcactcgcg
cagtggcccgcactgctcacgctcgctggtgacctgcgcgcgccgcatcgcatcgcgcac
tacctggaagacctcgccgccgcataccacaagtggtacaacgtcgagcgcgtggtgccg
atgccgctcaccgaagcggaggagcgcgccgatgagcagacccgcgaacgcacccgcatc
gcgaagaacccggagcccgcgcgcgcggccgcccgactgaagctcaacgacgccgtgcag
accgtgatcgccgaaggcctcgacctgctaggcgtgaccgcccccgacaagatgtaa

DBGET integrated database retrieval system