KEGG   Bacteroides ovatus: Bovatus_00909Help
Entry
Bovatus_00909     CDS       T04113                                 

Gene name
fhs
Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
boa  Bacteroides ovatus
Pathway
boa00670  One carbon pool by folate
boa01100  Metabolic pathways
boa01120  Microbial metabolism in diverse environments
boa01200  Carbon metabolism
Module
boa_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:boa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Bovatus_00909 (fhs)
Enzymes [BR:boa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Bovatus_00909 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA ParA AAA_31 AAA_26 ArsA_ATPase
Motif
Other DBs
NCBI-ProteinID: ALJ45566
UniProt: A0A139L395
Position
complement(1121376..1123043)
Genome map
AA seq 555 aa AA seqDB search
MKSDIEIARSIELKKIKQVAEGIGIPREEVENYGRYIAKIPEQLIDEEKVKKSNLILVTA
ITATKAGIGKTTVSIGLALGLNKIGKNAIVALREPSLGPCFGMKGGAAGGGYAQVLPMDK
INLHFTGDFHAITSAHNMISALLDNYLYQNQAKGFGLKEILWRRVLDVNDRSLRSIVVGL
GPKSNGITQESGFDITPASEIMAILCLSKDVSDLRRRIENILLGFTYDDQPFTVKDLGVA
GAITVLLKDAIHPNLVQTTEGTAAFVHGGPFANIAHGCNSILATKLAMSFGDYVITEAGF
GADLGAEKFYNIKCRKSGLQPRLTVIVATAQGLKMHGGVSLDRIKEPNMEGLKEGLRNLD
KHVRNLRSFGQTIIVAFNKFASDTDEEMELLREHCEQLGVGFAINNAFSEGGEGAVDMAR
LVVDTIENNPSESLRYTYKEEDSIQQKIEKVATNIYGASVITYSSIARNRIKLIEKMGIT
HYPVCIAKTQYSFSADPKIYGAVNNFEFHIKDIVINNGAEMIVAIAGEILRMPGLPKEPQ
ALHIDIVDGEIEGLS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagacatagaaatagctcgcagtattgagctgaagaagattaagcaagttgcc
gaaggtatcggaatccctcgtgaggaagtggagaattatggccgctacatagcaaagatc
cccgaacaactgattgatgaagagaaagtgaagaaaagcaatctcattctggtaactgct
atcacagcaaccaaagcgggcattggcaaaactacagtatctatcggtctcgctttggga
ttgaataaaattggaaagaatgcgattgtcgctcttcgcgagccgtctctcggtccatgt
ttcggaatgaagggaggagcagccggtgggggatatgcacaagtgcttccgatggacaaa
attaacctccattttaccggagattttcatgccatcacttctgcccataacatgatttcc
gccctgctcgataattatctctatcagaaccaggcaaaaggtttcggattgaaagaaatt
ctttggcggagagtgcttgacgtgaacgaccgttcgttgcgcagcatcgttgtcggcctc
ggacctaaatcgaacgggattacccaagagtccggtttcgatattactcctgcttcggag
attatggcaattctttgcctttccaaagatgtgagtgatctgcgtcgccgtattgaaaat
atcctgttgggcttcacgtatgacgaccaaccttttactgtgaaagatttgggagtggca
ggagccatcactgtgttgttgaaagatgctatccatcctaatttagtgcagactaccgaa
ggaaccgctgcttttgtacatggtggtccgtttgctaatatcgcacatggttgtaactct
attctggccactaaattggcaatgtctttcggtgattatgtaataacagaagccggattc
ggtgccgatctcggtgcagaaaaattctataatatcaaatgccgcaagagcggactccaa
ccacgtctcacggtgattgtcgctacggcacaaggattaaagatgcacggaggtgtcagt
ctcgaccgtatcaaagagccgaatatggaaggcttgaaagaaggattgcgtaatctcgac
aaacacgttcgtaaccttcgctcattcggtcagaccatcatcgtagctttcaataagttt
gcatccgatacggatgaagaaatggaattactgcgcgaacattgcgaacagttgggagtg
ggtttcgccattaacaatgcgttcagtgaaggaggagagggagcagtagatatggcccgt
ctggtagtagataccatagagaacaatccgtccgaatctttacgctacacttataaagaa
gaagatagcatacagcagaagattgaaaaggtagccactaatatttacggagccagcgtt
attacttatagcagtattgcccgcaaccgtatcaaactgatcgagaaaatgggaattact
cattatccggtttgtattgcgaaaacacaatattcattttctgccgatccaaagatttat
ggtgcggtaaacaacttcgagttccatattaaagatattgttatcaataacggagctgaa
atgattgtagccattgccggagaaattcttcgtatgccgggattacccaaggagccgcag
gcattgcacatcgatattgtggatggagaaatagaaggattgagctaa

DBGET integrated database retrieval system