KEGG   Bacteroides ovatus: Bovatus_03422Help
Entry
Bovatus_03422     CDS       T04113                                 

Definition
(GenBank) O-Glycosyl hydrolase family 30
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
boa  Bacteroides ovatus
Pathway
boa00511  Other glycan degradation
boa00600  Sphingolipid metabolism
boa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Bovatus_03422
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bovatus_03422
Enzymes [BR:boa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Bovatus_03422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2 DUF5054
Motif
Other DBs
NCBI-ProteinID: ALJ48029
Position
4329521..4331002
Genome map
AA seq 493 aa AA seqDB search
MRNIALTFLGCFTILAACSNSDDAEKPVAPIPTGDVTIYSTTNSLTRDLTRDAVNFSLKD
NLAPTSITLNPTEQYQTMDGFGVAITGATCFNLLQMKPEDRHAFLTETFSDDKGFGFSYI
RISIGCSDFSLSEYTCCDKKGIENFALQSEEKEYILPILKEILDINPSIKIIAAPWTCPT
WMKVKSLTDLTPFESWTNGQLNPAYYQDYATYFVKWVQAFNAEGIDIYAVTPQNEPLNRG
NSASLYMSWEEQRDFVKTALGPKFKTAGLATKIYAYDHNYDYSDIETEKNYPGKMYEDPA
ASQYLAGAAYHNYGGNREELLNMHKAYPEKELLFTETSIGTWNSGRDLSKRLLEDMKEVA
LGTINNWCKGVIVWNLMLDNDRAPNREGGCQTCYGAVDISNSDYKTIIRNSHYYIIAHLS
SVVKPGALRIGATGYADSNIMYSAFENPDGTYAFVLMNNNEKTKRITFSDGKRHFAYDVP
GKSVTSYRWAKSE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatatagcattgacttttttaggatgtttcaccatattagctgcatgcagcaac
agtgacgatgcggaaaaacctgtggcacccattcccaccggagatgtgactatttattcc
accaccaatagtctgactcgcgatttgactcgtgatgccgttaatttcagtttgaaagat
aacttggcgcctacttccattacattgaacccgactgaacaatatcagacaatggacggc
tttggcgtagctatcacaggtgctacctgttttaatcttctgcaaatgaaaccggaagac
cgccatgctttcctgacggaaacgttctctgatgacaaaggcttcggatttagctatatc
cgtatctctattggttgctcggacttctcattgagtgaatatacttgttgtgataagaaa
ggtattgaaaattttgctctacagagtgaagaaaaagagtatattctgcctattctgaaa
gagattctggacatcaatccttctataaaaattattgccgcaccttggacatgtccaaca
tggatgaaggtgaaaagcctcacagaccttactccatttgagtcatggacaaacggtcag
ctcaatcctgcctattatcaggattatgccacttattttgtaaaatgggtgcaagccttc
aacgctgagggtattgatatctatgccgtaactccacagaacgaaccgttgaatcgtggt
aattccgcttcactttatatgagttgggaagaacagagagacttcgtaaaaacagcactt
ggtcctaaattcaaaacagccggattagctacgaagatttatgcatacgatcataattat
gattatagcgatattgaaacagaaaagaactaccccggtaagatgtatgaagacccggct
gcttcccaatatctggccggagctgcttatcacaactatggcggcaaccgcgaagaactt
ttgaatatgcacaaagcttatcctgaaaaagaacttcttttcacggagacttctatcgga
acctggaacagcggacgcgacttgtcgaaacgattgctggaagatatgaaggaagttgca
ttgggtacaatcaataactggtgtaaaggtgttatcgtatggaacctgatgcttgataat
gaccgtgctcctaaccgtgaaggcggttgccagacttgctacggagcagtggatatcagt
aatagcgactataagacaattatccgtaactcacattattatatcatcgctcatctttca
agtgtagtgaaaccaggagccctacgtatcggtgccacaggttatgccgacagcaatatc
atgtattctgctttcgagaatccggacggaacatacgcttttgtcctgatgaataacaat
gaaaagaccaagagaataacctttagtgacggcaagcgccattttgcttatgatgttcct
ggcaaatctgtgacttcctatcgttgggcaaagtcggaataa

DBGET integrated database retrieval system