KEGG   Bacteroides ovatus: Bovatus_03698Help
Entry
Bovatus_03698     CDS       T04113                                 

Gene name
nagA_3
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
boa  Bacteroides ovatus
Pathway
boa00520  Amino sugar and nucleotide sugar metabolism
boa01100  Metabolic pathways
boa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:boa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bovatus_03698 (nagA_3)
Enzymes [BR:boa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Bovatus_03698 (nagA_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ALJ48303
UniProt: A0A3D2LVY6
Position
complement(4724195..4725382)
Genome map
AA seq 395 aa AA seqDB search
MERLIITNGKLILPTGIEMGQTLICENGKIEQIIPNGSYQPLVGDKVIDARQNYVSPGFI
DMHIHGGGGHDFMDGTVEAFLGVAETHAKYGTTAMVPTTLTSTIEELMTTFTVYRKAKEM
NINGSQFIGLHLEGPYFSPKQCGAQDPNFLKKPQAEEYNAILEASKDIIRWSVAPELEGA
LALGQTLQQHHILPSIAHTDAIYEEVEKAFTAGYTHVTHLYSAMSSVTRKNAFRYAGVVE
ATYLIEDMTVEIIADGIHLPKPLLQFVYKFKGVDKTALCTDAMRGAGMPDGESILGSLNN
GQKVIIEDGVAKMPDRKAFAGSVATTDRLVRTMIYLAGVPLIDAVRMMSLTPARILHIDK
EKGSLEIGKDADIVIFDNQININNTILKGHVIYTK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaaagactcatcataacaaatggaaaactcatcctgccaacaggcatagaaatgggc
caaacattgatatgcgaaaatggaaaaattgagcagattattcccaatggaagctatcaa
ccgctcgtcggtgacaaggtaatagacgcccgtcagaattatgtttcaccaggattcatc
gacatgcatatccacggaggaggaggacatgacttcatggatggtactgttgaggctttt
ctcggagtggccgagacacatgccaagtatggtactaccgcaatggttcccaccacactc
accagcactattgaggagttaatgacgacgtttaccgtatatcggaaagccaaagaaatg
aatatcaatggttcgcagtttatcggtttacatttggaaggaccttacttttcaccgaaa
caatgtggtgcgcaagacccgaacttcctgaaaaagccgcaagcagaagaatataatgcc
attctggaagcctcaaaagatattatccgttggagcgtagctcctgagttggagggtgct
ctagcactagggcaaactctgcaacaacatcatattctcccctccatcgctcataccgac
gcgatttatgaagaagttgagaaagcctttacagcaggttatacacatgtgacccacctt
tattcggccatgtcatcagtgacccgcaaaaatgctttccgctatgccggagtagtagaa
gccacctacttgattgaagatatgacagtggagattattgccgatggcatacatcttccg
aaacccctgctccaattcgtatacaagttcaaaggagttgataaaacagccctctgcact
gatgccatgagaggagcgggtatgccggacggtgaatcgatattaggtagcctcaacaac
ggtcagaaagtcattatcgaagacggagtggccaaaatgccggatcggaaagcttttgcc
ggtagtgttgcaacaaccgaccgactggttcgaaccatgatatatttagccggtgttcct
ctcattgacgccgtccgtatgatgagcctgacgcccgcccgtattcttcatattgacaaa
gaaaaaggttctttagaaatcggtaaggatgccgacatagtcatttttgataatcaaata
aatataaataatacaatattaaaaggccatgttatctatactaaatga

DBGET integrated database retrieval system