KEGG   Burkholderia oklahomensis C6786: BG90_1586Help
Entry
BG90_1586         CDS       T03861                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00360  Phenylalanine metabolism
boc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
boc00790  Folate biosynthesis
boc01100  Metabolic pathways
boc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BG90_1586 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BG90_1586 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BG90_1586 (phhA)
Enzymes [BR:boc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BG90_1586 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AJX31800
Position
I:complement(1753161..1754054)
Genome map
AA seq 297 aa AA seqDB search
MSTVVTAKLKEQFDAGLETRADFTIDQPLARYGEVDHAVWKQLYTRQASLLRGRACDAFV
GGLARIDLSPERVPSFADVNRRLEPATGWRIVAVPGLVPDAVFFEHLANRRFPVTWWMRR
PDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMHAYGRAALAVADDPRALALLARLYWYTV
EFGLIRDARPENGLRIYGAGIVSSKGETLYSLESPAPNRIGFDLERVMRTRYRIDTFQKT
YFVIDDFAQLFALAHVDARALAARLADAPEHAAGAVLDGDRVLTRGTGEGWAIDEDA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcgtcaccgcgaaactgaaggaacagttcgacgcgggcctcgaaacccgt
gccgatttcaccatcgatcaaccgctcgcccgctacggcgaagtcgaccacgcggtgtgg
aagcagctctatacgcgccaggcgtcgctgctgcgcggccgcgcgtgcgacgcgttcgtc
ggcggcctcgcgcgcatcgacttgtcgcccgagcgcgtgccgtcgttcgccgacgtgaac
cgtcggctcgagcccgcgaccggctggcggatcgtcgccgtgccgggcctcgtgccggac
gccgtgttcttcgagcatctcgcgaaccggcggtttccggtcacctggtggatgcgtcga
ccggaccagctcgactacctgcaggagccggactgcttccacgatctgttcggccacgtg
ccgctcctgatcgatcccgtcttcgccgactacatgcacgcgtacggtcgcgcggcgctt
gccgtcgccgacgatccgcgcgcgctcgcgctgctcgcgcgcctctattggtatacggtc
gaattcggcctgatccgcgacgcgcgcccagaaaacgggctgcggatctacggcgcgggc
atcgtgtcgagcaagggcgagacgctctacagcctcgagagcccggcgccgaaccggatc
ggcttcgatctcgagcgcgtgatgcggacccgttaccggatcgacacgttccagaagacc
tacttcgtgatcgacgatttcgcacagctctttgcgctcgcgcacgtcgacgcacgcgca
ctcgccgcccggctcgccgacgcgcccgagcacgcggcgggcgcggtgctcgacggcgat
cgcgtgctcacgcgcggcacgggcgaaggctgggcgatcgatgaagacgcttga

DBGET integrated database retrieval system