KEGG   Burkholderia oklahomensis C6786: BG90_1806Help
Entry
BG90_1806         CDS       T03861                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:boc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BG90_1806 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:boc03011]
    BG90_1806 (rplV)
Ribosome [BR:boc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BG90_1806 (rplV)
  Bacteria
    BG90_1806 (rplV)
  Archaea
    BG90_1806 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: AJX31778
Position
I:2002985..2003314
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcagaagacgcgccttgtg
gctgaccagatccgcggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggcggctggcatcgtgaagaaggtcgtgctgtcggcgatcgcgaatgcggagcac
aacgaaggcgccgatatcgacgagctcaagatcaagagcatctacgtcgacaaggctgca
tcgctcaagcgcttcaccgcgcgcgccaagggccgcggcaaccgcattgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system