KEGG   Burkholderia oklahomensis C6786: BG90_2961Help
Entry
BG90_2961         CDS       T03861                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00480  Glutathione metabolism
boc00590  Arachidonic acid metabolism
boc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BG90_2961
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BG90_2961
Enzymes [BR:boc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BG90_2961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AJX32655
Position
I:3279567..3280046
Genome map
AA seq 159 aa AA seqDB search
MSELYSFSAQALTGGEVPLEQYRGKVLLIVNTASECGFTPQYGGLQQLYDRFRERGLVVL
GFPCNQFGKQEPGDASQIGAFCEKNFGVTFPMFAKIDVNGANAHPLYRYLTEEAPGILGL
KAIKWNFTKFLVSREGEIVKRYAPSTKPDDIAEDVEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaactttattcattcagcgcgcaggcgctcacgggcggcgaggtgccgctcgag
cagtacaggggcaaggtgctcctcatcgtcaacaccgcgagcgagtgcgggttcacgccg
caatacggggggctgcagcagctgtacgaccgctttcgcgaacgcgggctcgtcgtgctc
ggctttccgtgcaaccagttcggcaagcaggagccgggcgacgcgtcgcagatcggcgcg
ttctgcgagaagaacttcggcgtcacgtttccgatgttcgcgaagatcgacgtgaacggc
gcgaatgcgcatccgctgtaccgctatctgaccgaggaggcgcccggcattctcggcctc
aaggcgatcaagtggaatttcacgaaatttctcgtgagccgggagggcgagatcgtcaag
cgctacgcgccgtcgacgaagcccgacgatatcgccgaggacgtcgagaagctgctctga

DBGET integrated database retrieval system