KEGG   Burkholderia oklahomensis C6786: BG90_3240Help
Entry
BG90_3240         CDS       T03861                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00071  Fatty acid degradation
boc00072  Synthesis and degradation of ketone bodies
boc00280  Valine, leucine and isoleucine degradation
boc00310  Lysine degradation
boc00362  Benzoate degradation
boc00380  Tryptophan metabolism
boc00620  Pyruvate metabolism
boc00630  Glyoxylate and dicarboxylate metabolism
boc00640  Propanoate metabolism
boc00650  Butanoate metabolism
boc00900  Terpenoid backbone biosynthesis
boc01100  Metabolic pathways
boc01110  Biosynthesis of secondary metabolites
boc01120  Microbial metabolism in diverse environments
boc01130  Biosynthesis of antibiotics
boc01200  Carbon metabolism
boc01212  Fatty acid metabolism
boc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:boc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG90_3240
   00630 Glyoxylate and dicarboxylate metabolism
    BG90_3240
   00640 Propanoate metabolism
    BG90_3240
   00650 Butanoate metabolism
    BG90_3240
  Lipid metabolism
   00071 Fatty acid degradation
    BG90_3240
   00072 Synthesis and degradation of ketone bodies
    BG90_3240
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BG90_3240
   00310 Lysine degradation
    BG90_3240
   00380 Tryptophan metabolism
    BG90_3240
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BG90_3240
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BG90_3240
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BG90_3240
Enzymes [BR:boc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BG90_3240
Exosome [BR:boc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BG90_3240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJX32751
UniProt: A0A1B4ATU9
Position
I:3622135..3623316
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGATVIRAVLERAGVKPEQISEVILGQVLTAG
SGQNPARQALIAAGLPSAVPGMTINKVCGSGLKAVMLAANAIVAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNKYHMGVTAENVAKEYGITREEQDQFAA
LSQNKAEAAQKAGRFDDEIVPVEIPQRKGEPLRFATDEFVRHGVTAESLAGLKPAFAKDG
TVTAANASGINDGAAAVLVMSAKKAEALGLEPLARIKAYANAGVDPSVMGMGPVPASRRC
LERAGWSVGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKRGLASLCIGGGMGVALAVERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgtaccgcggtcggcaagttcggcggctcg
ctcgcgaagatcgccgcgccggagctcggcgcgacagtgatccgcgcggtgctcgagcga
gcgggcgtgaagccggagcagatcagcgaagtgatcctgggccaggtgctgacggcgggc
tcgggccagaacccggcgcgccaggcgctgatcgcggcggggctgccgagcgcggtgccc
ggcatgacgatcaacaaggtgtgcggctcgggcctgaaggccgtgatgctcgccgcgaac
gcgatcgtcgcgggcgatgcggaaatcgtcgtcgcgggcggccaggagaacatgagcgcc
gcgccgcacgtgctgccgggctcgcgcgacggctttcggatgggcgacgcgaagctcgtc
gacagcatgatcgtcgacggcctgtgggacgtctataacaagtaccacatgggcgtcacg
gcggagaacgtcgcgaaggaatacggcatcacgcgcgaagagcaggaccagttcgccgcg
ctgtcgcagaacaaggcagaagccgcgcagaaggcgggccgcttcgacgacgagatcgtg
ccggtcgagatcccgcagcgcaagggcgagccgcttcgcttcgcgaccgacgagttcgtc
cgccacggcgtgacggccgagtcgctcgcgggcctgaaacccgcattcgcgaaggacggc
acggtgacggccgcgaacgcgtccggcatcaacgacggcgcggccgcggtgctcgtgatg
tcggcgaagaaggccgaggcgctcggcctcgagccgcttgcgcggatcaaggcgtatgcg
aacgcgggcgtcgatccgagcgtgatgggcatgggtcccgtgccggcatcacgacgctgt
ctcgagcgcgcgggctggtcggtcggcgatctcgacctgatggagatcaacgaggcgttc
gccgcgcaggcgctcgcggtccacaagcagatgggctgggatacgtcgaaggtcaacgtg
aacggcggcgcgatcgcgatcggccatccgatcggcgcatcgggctgccggatcctcgtc
acgctgctgcacgaaatgcagaagcgcgatgcgaaacgcggcctcgcgtcgctttgcatc
ggcggcggaatgggcgtcgcgctcgcggtcgagcgtccgtaa

DBGET integrated database retrieval system