KEGG   Burkholderia oklahomensis C6786: BG90_4644Help
Entry
BG90_4644         CDS       T03861                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00030  Pentose phosphate pathway
boc00480  Glutathione metabolism
boc01100  Metabolic pathways
boc01110  Biosynthesis of secondary metabolites
boc01120  Microbial metabolism in diverse environments
boc01130  Biosynthesis of antibiotics
boc01200  Carbon metabolism
Module
boc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
boc_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BG90_4644 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BG90_4644 (gnd)
Enzymes [BR:boc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BG90_4644 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BG90_4644 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 ApbA Shikimate_DH F420_oxidored 3HCDH_N 2-Hacid_dh_C PGK
Motif
Other DBs
NCBI-ProteinID: AJX34267
Position
II:1198701..1200116
Genome map
AA seq 471 aa AA seqDB search
MGKQAIGVVGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFPDRKLVPAHTLEAF
VASLETPRRILLMVKAGEATDATIAALKPLLDKGDVLIDGGNTHFTDTIRRNQELAQAGL
HFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPADGEPCVAYMGPDGAG
HYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNDELGAVYTEWNQGELDSYLIEITAKIF
GKKDDETGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKDQRVA
ASKVLTGPAPAPLEGDRAAFVESVRRALYLSKVISYAQGFAQLDTASKEYGWHLDLGTIA
KIFRAGCIIRARFLQKITDAYAKNAALANLLLDPYFQDIAANYQSSLRDVVVAAVNAGVP
VPAFASAIAYFDSYRSARVPANLVQAQRDFFGAHTFERTDKPGSFHANWTE
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaacaagcaatcggtgtggtcggtctcgcggtgatggggcgcaatctcgccttg
aatatcgaaagccgtggctacgcggtgtcggtctacaaccgcagccgcgagaagaccgac
gaactgatcgccgaatttcccgatcgcaagctcgtgccggctcatacgctcgaggcgttc
gtcgcgtcgctcgagacgccgcgccgcatcctcctgatggtgaaggcgggcgaagcgacc
gatgcgacgatcgcggcgctcaagccgctgctcgacaagggcgacgtgctgatcgacggc
ggcaacacgcacttcaccgatacgatccgccgcaaccaggaactcgcgcaggcggggctg
cacttcatcggcacgggcgtgtcgggcggcgaggagggcgcgctgcgcggtccgtcgatc
atgccgggcggccagcgcgacgcgtacgatctcgtcgagccgatcctcaagcagatcgcc
gcgaaggcgcccgccgacggcgagccgtgtgtcgcctacatgggcccggacggcgcgggc
cactatgtgaagatggtccacaacggaatcgagtacggcgacatgcagttgatcgccgag
agctacgcggtgctcaagcaggtcgcgggcctgacgaacgacgagctcggcgcggtctac
accgaatggaaccagggcgaactcgacagctacctgatcgagatcaccgcgaagatcttc
ggcaagaaggacgacgaaaccggtaagcacctcgtcgacgtgattctcgaccgcgccgcg
cagaaaggcacgggcaagtggacgagccagaacgcgctcgatctcggcgtgccgctgccg
ctcatcaccgaatcggtgttcgcgcgcgtgctgtcgtcgctgaaggatcagcgcgtcgcg
gcgagcaaggtgctgaccgggccggcgcccgcgccgctcgaaggcgatcgcgccgcattc
gtcgagtcggtgcggcgcgcgctgtacctgtcgaaggtgatctcgtacgcgcagggcttc
gcgcagctcgacacggcgtcgaaggaatacggctggcacctcgatctcggcacgatcgcg
aagattttccgtgcgggctgcattatccgcgcgcgtttcctgcagaaaatcaccgatgcg
tacgcgaagaatgcggcgctcgcgaatctgctgctcgatccgtacttccaggacatcgcc
gcgaactatcagtcctcgctgcgcgacgtcgtggtcgcggcggtgaacgcgggcgtgccg
gtgccggcgttcgcgtcggcgatcgcgtacttcgacagctaccggtcggcgcgcgtgccg
gcaaaccttgtgcaggcgcaacgcgactttttcggcgcgcatacgttcgagcgcacggac
aagccgggcagcttccacgcgaactggaccgagtga

DBGET integrated database retrieval system