KEGG   Burkholderia oklahomensis C6786: BG90_5332Help
Entry
BG90_5332         CDS       T03861                                 

Definition
(GenBank) aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain protein
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00220  Arginine biosynthesis
boc01100  Metabolic pathways
boc01110  Biosynthesis of secondary metabolites
boc01130  Biosynthesis of antibiotics
boc01230  Biosynthesis of amino acids
Module
boc_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BG90_5332
Enzymes [BR:boc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BG90_5332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace
Motif
Other DBs
NCBI-ProteinID: AJX34094
Position
II:complement(2001173..2001643)
Genome map
AA seq 156 aa AA seqDB search
MEHSARQLFHPPAPLPATTPASQRAIAPRRLPFTLLIELTDDPLAAVKGVDFVYTDVWVS
MGEPVTAWGARIALLKPYQVDTRLMQATGKPRTRFMHCLPAYHDLETDTAREVHAHYGLT
ELEVTDEVFESEASIVFSQAENRMHTIKAVLVATLG
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggagcattccgccaggcagttgttccatccgccggcaccgctccccgcgacgacgccc
gcgtcgcagcgggcgatcgcgccgcgccggcttccgttcacgctgctgatcgagctgacc
gacgatccgctcgccgcggtgaaaggcgtcgacttcgtctacacggacgtctgggtgtcg
atgggcgagcccgtgacggcgtggggcgcgcggatcgcgctgctgaagccgtatcaggtc
gacacgcggctgatgcaggcgaccggcaagccgcgcacgcgcttcatgcactgcctgccc
gcgtatcacgatcttgagaccgacaccgcgcgcgaggtccacgcgcactacgggctcacc
gagctcgaagtgaccgacgaggtgttcgaatcggaggcgtcgatcgtgttctcgcaggca
gagaaccggatgcacacgatcaaggcggtgctcgtcgccacgctcggctga

DBGET integrated database retrieval system