KEGG   Burkholderia oklahomensis C6786: BG90_5370Help
Entry
BG90_5370         CDS       T03861                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00260  Glycine, serine and threonine metabolism
boc01100  Metabolic pathways
boc01110  Biosynthesis of secondary metabolites
boc01120  Microbial metabolism in diverse environments
boc01130  Biosynthesis of antibiotics
boc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BG90_5370 (ltaA)
Enzymes [BR:boc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BG90_5370 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3 Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AJX33912
Position
II:2044986..2046059
Genome map
AA seq 357 aa AA seqDB search
MIDFLSDTVTLPTAEMRHAMFTANVGDDCYGEDPTVNELESVAAGMTGKEAAAFVTSGTL
GNLTALLAQCPRGHEVILGDRSDLYNYEAGGVSFVGGAVLHPVATADDGSLPLERLRAAI
RDKTDYQCAPAAVIALENPHCLAGGRVLSLDYLRHVRALADEHGLAVHMDGARLFNAQAS
LGASAADIVAHVDSVQFCLSKSLAAPYGSMVCGSADLIDRVKRYRKLLGGGTRQAGIMAA
AGLVALRTMVARLSDDHRRAARLAAELSRIPGIALRSAAVETNMVFFDVVEPGNEAFLAA
LRDAGIRMGVLGDGVIRAVVHYMIDDDAISRTVDAARAILRPFAPASQPAAVPEAQR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttcctgagcgacacggtgacgctgccgaccgccgagatgcggcacgcgatg
ttcacggcgaacgtgggcgacgactgttacggcgaggatccgacggtcaacgagctggag
tcggttgcggccggcatgaccggcaaggaggcggcggcgttcgtcacgagcggcacgctc
ggcaacctgaccgcgctgctcgcgcaatgcccgcgcgggcacgaagtgatcctcggcgat
cgctccgacctgtacaactacgaggcgggcggggtgtcgttcgtcggcggcgcggtgctg
catcccgtcgcgaccgcggacgacggcagcctgccgctcgagcggctgcgcgcggcgatc
cgcgacaagaccgactaccagtgcgcgcccgccgcggtgatcgcgctcgagaatccgcat
tgcctcgccggcggccgcgtgctgtcgctcgactacctgcggcacgtgcgcgcgctcgcc
gacgagcacgggctcgccgtgcacatggacggcgcgcgcctcttcaacgcacaggcgagc
ctcggcgcgagcgcggccgacatcgtcgcgcacgtcgattcggtccagttctgcctgtcg
aagagcctcgccgcgccatacggctcgatggtgtgcggcagcgccgacctgatcgatcgc
gtgaagcgctaccggaagctgctcggcggcggcacgcggcaggccggcatcatggcggcc
gccgggctcgtcgcgctgcgcacgatggtcgcgcggctgtccgacgatcaccgccgcgcg
gcgcgcctcgccgcggagctgtcgcggatcccgggcatcgcgctgcgctcggcggcggtc
gagacgaacatggtgttcttcgacgtcgtcgagccgggcaacgaagcgtttctcgccgcg
ctgcgcgacgcgggcatccggatgggcgtgctcggcgacggcgtcatccgggccgtcgtg
cattacatgatcgacgacgacgcgatcagccgcaccgtcgacgcggcgcgggcgattctc
cgtccgttcgccccggcgtcccagccggccgccgtgccggaggcgcaacgatga

DBGET integrated database retrieval system