KEGG   Burkholderia oklahomensis C6786: BG90_555Help
Entry
BG90_555          CDS       T03861                                 

Definition
(GenBank) hypothetical protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:boc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BG90_555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:boc02022]
    BG90_555
Two-component system [BR:boc02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BG90_555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C B12-binding FleQ
Motif
Other DBs
NCBI-ProteinID: AJX32664
Position
I:complement(605347..606072)
Genome map
AA seq 241 aa AA seqDB search
MTTQILIVDDDQELRDLLRDYLVRQGIEVSVLHDAASLEKRLERERPDLIVLDLMMPGVD
GLTALRQLRAAGDDIPVIMLTARADDVDRIVGLELGADDYLGKPFNPRELLARAQAVLRR
RRATPSAAAPEQREPYAFGRFVLDFQARTLSVDGKPATLSSSEFALLKIFVNHALRTLTR
ERLLELLHGPEYDGTDRGIDVQVWRLRRILETDPSTPRFIQTVRGRGYVFVPNGEAHAQT
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgactactcagatcctcatcgtcgacgacgaccaagaactgcgcgacctgctgcgcgac
tacctcgtgcggcaaggcatcgaggtgtccgtgctgcacgacgccgcttcgctcgaaaag
cgcctcgaacgcgagcgccccgatctcatcgtgctcgacctgatgatgccgggcgtcgac
ggcctgaccgcgctgcgtcagctccgcgcggcgggcgacgacattccggtgatcatgctg
acggcgcgtgcggacgacgtcgaccgcatcgtcggcctcgagctcggcgcggacgattac
ctcggcaagccgttcaacccgcgcgagctgctcgcgcgcgcgcaggcggtgctgcgccgc
cgccgcgcgacgccgtcggcggccgcgcccgagcagcgcgagccgtacgcgttcggccgt
ttcgtgctcgatttccaggcgcgcacgctgtcggtcgacggcaagccggcaacactgtcg
agcagcgaattcgcgctcctgaagatcttcgtcaaccatgcgctgcgcacgctgacccgc
gagcgcctgctcgaactgctgcacggccccgagtacgacggcaccgaccgcgggatcgac
gtgcaggtctggcgactgcgccggatcctcgaaaccgatccgtcgacgccgcgcttcatc
cagacggtgcgcggacgcggctacgtgttcgtgccgaacggcgaggctcatgcgcaaacc
cattga

DBGET integrated database retrieval system