KEGG   Burkholderia oklahomensis C6786: BG90_6004Help
Entry
BG90_6004         CDS       T03861                                 

Definition
(GenBank) beta-lactamase superfamily domain protein
  KO
K20257  2-aminobenzoylacetyl-CoA thioesterase [EC:3.1.2.32]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00405  Phenazine biosynthesis
boc01110  Biosynthesis of secondary metabolites
boc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    BG90_6004
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BG90_6004
Enzymes [BR:boc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.32  2-aminobenzoylacetyl-CoA thioesterase
     BG90_6004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2 PDEase_II
Motif
Other DBs
NCBI-ProteinID: AJX35061
Position
II:complement(2817201..2818097)
Genome map
AA seq 298 aa AA seqDB search
MQHSTPGWIDSQLAIVGSAEVPLYVVVNDEAATLIEGGLSGMTELVWRQLHDLLKDYGGI
RHLRYWLITHSHYDHCSLLGTLKARMPWLHVVGSPDTADALQSPSACRTIRKLDAQASVA
WEPIAEADLADLSEIPLYPVNPGTALDIGEGMRMRAIALPGHSACLFGYHCPQLDLLFVS
DALGEYHGPKRWLPLVFQDLSAYRQSLAVIERQQASRIALGHHGIVGGDVARHAVRHARD
GLAARNDEACAMRGDAAATRALAQQWTERYAARSANVVPRTLHLKSMERMIDLFQRAA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacagcacccctggctggatcgactcgcagctcgccatcgtcggaagcgcggaa
gtgccgctgtacgtggtcgtcaacgacgaagccgcgacgctgatcgaaggcgggttgagc
ggcatgaccgagctggtgtggcggcagcttcacgatctgctgaaggactacggcggcatc
cggcatctgcgctactggctgatcacgcattcgcactacgaccattgcagcctgctcggg
accttgaaggcgcggatgccgtggctgcacgtcgtcggctcgcccgacaccgccgacgcg
ctgcagagcccgtccgcgtgcaggacgatcagaaagctcgacgctcaggcgtccgttgcg
tgggagccgatcgccgaagccgatctcgcggacctgtccgaaatcccgctgtacccggtc
aatccgggcacggcgctcgacatcggcgaagggatgcggatgcgcgcgatcgcgctgccc
ggccacagcgcctgcctgttcggctatcactgcccgcagctcgacctgctgttcgtgtcg
gacgcgctcggcgaataccacgggccgaagcggtggctgccgctcgtgtttcaggatctg
tccgcgtaccggcagtcgctcgccgtcatcgagcggcagcaggcatcgcggattgcgctg
ggtcatcacgggatcgtcggcggcgacgtcgcgcggcacgcggtccggcacgcgcgggac
ggcctcgcggcgcgcaacgacgaagcatgcgcgatgcgcggcgacgcggccgcgacgcgc
gcgctcgcgcagcaatggaccgagcgctatgcggcgcgcagcgcgaacgtggtgccgcgc
acgctgcatctgaagagcatggagcgaatgatcgacctgttccagcgcgccgcatag

DBGET integrated database retrieval system