KEGG   Brassica oleracea (wild cabbage): 106295243Help
Entry
106295243         CDS       T04124                                 

Definition
(RefSeq) heat shock 70 kDa protein 5
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03040  Spliceosome
boe04141  Protein processing in endoplasmic reticulum
boe04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106295243
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106295243
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106295243
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:boe01009]
    106295243
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:boe03041]
    106295243
   03009 Ribosome biogenesis [BR:boe03009]
    106295243
   03110 Chaperones and folding catalysts [BR:boe03110]
    106295243
   04131 Membrane trafficking [BR:boe04131]
    106295243
   03051 Proteasome [BR:boe03051]
    106295243
   03029 Mitochondrial biogenesis [BR:boe03029]
    106295243
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:boe04147]
    106295243
Protein phosphatases and associated proteins [BR:boe01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     106295243
Spliceosome [BR:boe03041]
 Complex B
  Other components
   Prp19 complex
    106295243
 Complex C
   Prp19-CDC5 complex
    106295243
Ribosome biogenesis [BR:boe03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    106295243
Chaperones and folding catalysts [BR:boe03110]
 Heat shock proteins
  HSP70 / DNAK
   106295243
Membrane trafficking [BR:boe04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    106295243
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    106295243
Proteasome [BR:boe03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    106295243
Mitochondrial biogenesis [BR:boe03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    106295243
Exosome [BR:boe04147]
 Exosomal proteins
  Proteins found in most exosomes
   106295243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR GLE1 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 106295243
NCBI-ProteinID: XP_013586550
UniProt: A0A0D3CAN6
Position
C5
AA seq 647 aa AA seqDB search
MAAKSDKAIGIDLGTTYSCVGAWINDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQ
VALNPHNTVFDAKRLIGRRFTDPSVQSDMRHWPFKVVSGPGDKPMIVVSYKNEEKQFSPE
EISSMVLVKMKEVAESFLGHTVKNAVVTVPAYFNDSQRQATKDAGSISGLNVLRIINEPT
AAAIAYGLDKKGTKTGERNVLIFDLGGGTFDVSLLTIEEGVFEVKATAGDTHLGGEDFDN
RLVNHFVAEFKRKHKKDVSGNARALRRLRTACERAKRTLSSTAQTTIEIDSLHEGVDFYA
TISRARFEEMNMDLFRKCMDPVEKVLRDAKLDKSRVHEVVLVGGSTRIPKIQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILTGEGSDKVQDLLLLDVAPLSLGIETAGGVMTVLIP
RNTTVPCKKEQVFSTYADNQPGVLIQVYEGERARTKDNNLLGTFELKGIPPAPRGVPQIN
VCFDIDANGILNVSAEDKTAGVKNQITITNDKGRLSKEEIEKMVQDAEKYKAEDEQVKKR
VEAKNSLENYAYNMRNTVRDEKLAQKLDQEGKQKIEKAIDEAIEWIEGNQLAEVDEFEYK
LKELEGICNPIISKMYQDGAGAGYPDGGMPASGGSGGAGGPKVEEVD
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaaatcggataaagctatcggcatcgatctcggcaccacatacagctgcgtc
ggagcgtggatcaacgaccgcgtggagatcatccccaacgaccaaggcaaccgcacgact
ccttcctacgtcgccttcaccgacacggagcggttgatcggcgacgcggcgaagaaccaa
gtcgcgctgaaccctcacaacaccgtcttcgacgcgaagcgtctcatcgggaggagattc
accgatccttctgttcagagcgatatgaggcactggcctttcaaggttgtctccggtccc
ggagataagccgatgatcgtcgtctcgtacaagaacgaagagaagcagttctctcccgag
gagatatcttcaatggtgttggttaagatgaaggaagtcgccgagtcctttttgggtcac
actgtcaaaaacgctgtcgttacggtccctgcgtactttaatgactctcagagacaggcc
acgaaggacgcgggttcgatctctgggcttaatgttttgagaatcatcaacgagcccact
gctgcagctattgcctatgggttagacaagaaagggaccaagactggtgagaggaacgtt
ttgattttcgatctcggcggtggaacgtttgatgtttcgttgttgacgattgaagaaggt
gtgttcgaggtgaaagctacggctggtgatactcacctcggtggtgaagactttgacaac
aggcttgtgaaccatttcgttgcggagttcaagaggaagcataagaaggatgtcagcggg
aacgcgagggcgttgaggaggctgagaacggcttgtgagagagcgaagagaacgctttcc
tccacggctcagacgactattgagatagattctttgcacgagggtgttgatttctacgcg
acgatatcccgcgcgaggtttgaggagatgaacatggatctcttcaggaaatgtatggat
cctgtggagaaagttctgagagatgctaagcttgacaagagccgtgtccacgaggtggtc
ctcgtgggaggatccacgaggattccgaagattcagcagcttctgcaagacttttttaat
ggaaaggagctttgtaaaagcattaaccctgatgaagctgttgcttacggagctgccgtt
caggccgcgattcttactggtgaaggaagcgacaaggtgcaagatcttctgcttcttgac
gtggcgccgctgagccttggcatcgagacggctggtggagtgatgactgtgcttatcccg
aggaacacgacggttccttgtaagaaggagcaagtgttctccacctatgcggacaatcag
cctggtgttctgatccaagtctatgaaggagagcgtgcgaggaccaaagacaacaacctt
cttggcacctttgagcttaaaggcattcctcctgcgccacgtggagttcctcaaatcaat
gtttgcttcgacattgacgccaatgggatcttgaacgtgtcggcggaggataaaaccgcg
ggggtgaagaaccagatcacgatcacgaacgacaaagggaggttgagcaaagaggagata
gagaagatggtgcaagatgctgagaagtacaaggcggaggatgagcaggtgaagaagaga
gtggaggccaagaactcgctggagaactatgcttacaacatgagaaacacggtcagggat
gagaaactggcgcagaagctagatcaagagggtaagcagaagatcgagaaggcgattgat
gaggcaattgagtggattgaagggaaccagctggcggaagttgacgagtttgagtataag
ttgaaagagctggagggtatctgtaacccaatcatctcaaagatgtatcaggatggtgcc
ggtgctggatatcccgatggtggtatgcccgcaagcggtggctccggtggtgctggaggt
ccgaaggtagaagaggttgattag

DBGET integrated database retrieval system