KEGG   Brassica oleracea (wild cabbage): 106295822Help
Entry
106295822         CDS       T04124                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00010  Glycolysis / Gluconeogenesis
boe00562  Inositol phosphate metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106295822
   00562 Inositol phosphate metabolism
    106295822
Enzymes [BR:boe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106295822
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106295822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 106295822
NCBI-ProteinID: XP_013587268
UniProt: A0A0D3C8W3
Position
C5
AA seq 487 aa AA seqDB search
MAMKTVWIVLLCLFVIAQADQGGFDVRHHLSTVTRYSVSKDVTQNLIEGSKVPSECTPIH
LNLVARHGTRSPTKKRLRELESLAGRLKELVRDAEARNLPSDKIPGWLGKWVSPWQGKVK
GGELIRQGEDELYQLGVRVRERFPTLFEEDYHPDVYTIRATQIPRASASAVAFGMGLFSE
KGDLGPGRNRAFAVTSENRASDTKLRFFECCQNYKSYRKAKEPAVDKLKEPVLNKITASV
AKRYGLSFTKQDVSSLWFLCKQEASLLNVTNQSCELFTPSEVALLEWADDLEVFILKGYG
NSLNYKMGVPLLEDVLHSMEAAIKAREENLPPGSYEKARLRFAHAETIVPFSCLLGLFLD
ASEFEKIQKEKPLELPPQPPKTRDFKGSTMAPFGGNNMLVLYSCPAASSPKYFVQVLHNE
HPIAVPGCDGKDFCPLEDFKAKVVTPHLKHAFDNLCNANLDDPKQNHPSGKLSFWSWLLG
SSQKTEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaagacggtttggatcgtactgctgtgtttgtttgttattgcacaggcagat
caaggtggtttcgatgttcgccatcacttatccaccgtcaccagatactctgtttcgaaa
gatgtcacacaaaatttgatcgaagggtcaaaagtccctagtgagtgtacacctatccac
ctcaacctcgtggctaggcatgggactcgttctcctactaagaaaaggttgcgagaactg
gagagtttagctggtaggttaaaggaacttgtaagagatgcagaagctagaaacttgcct
tcggacaagattcctggatggttagggaagtgggtttctccttggcaagggaaagtgaaa
ggcggggagctgataaggcaaggtgaggatgagttgtaccagcttggagtcagggttagg
gaacggttccccactttgttcgaagaggattatcaccctgatgtttataccattagagcc
acgcagattcctcgggcgtctgcgagtgctgtggcatttggaatggggttgttcagtgag
aaaggagacttgggaccagggcgtaatagagcgtttgctgtcactagtgagaaccgtgct
agtgataccaagctgaggtttttcgaatgttgtcaaaactacaagagttatagaaaagct
aaagagcctgctgtggataagctcaaggaacctgttctgaacaagattacagcttccgtt
gctaagagatatggtttgagtttcacgaaacaggacgtttcttctctctggtttctgtgc
aagcaggaagcatcattgcttaatgtaactaatcaaagctgtgaacttttcactccatct
gaggttgctttgctcgaatgggcagatgacttggaagtgtttattctcaaaggttatgga
aattcattgaactacaaaatgggagttccattgctcgaagatgttttgcattccatggaa
gcagctatcaaggcccgagaagaaaatctcccacctggaagttacgaaaaagcaagactt
aggtttgcacatgcagaaacaatagttcccttctcttgccttcttggacttttccttgat
gcatctgagtttgagaaaatacagaaggagaaaccgttggaactccctccacagcctcct
aaaaccagggactttaaaggcagcaccatggctccttttggtgggaacaacatgcttgtc
ctctacagctgtcctgcagcttcctcccccaagtacttcgtccaggttctgcacaacgag
catcctattgcagttcctggctgtgatggaaaagacttctgtcctcttgaagatttcaag
gccaaagtggtgacccctcacctcaagcatgcttttgacaacctctgcaatgctaatcta
gatgaccctaaacagaaccatccatcaggtaagttatctttttggagctggctgcttggg
tcgagccaaaaaaccgagctctaa

DBGET integrated database retrieval system