KEGG   Brassica oleracea (wild cabbage): 106295904Help
Entry
106295904         CDS       T04124                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 2 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00061  Fatty acid biosynthesis
boe00071  Fatty acid degradation
boe01100  Metabolic pathways
boe01212  Fatty acid metabolism
boe04146  Peroxisome
Module
boe_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106295904
   00071 Fatty acid degradation
    106295904
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106295904
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:boe01004]
    106295904
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:boe04147]
    106295904
Enzymes [BR:boe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     106295904
Lipid biosynthesis proteins [BR:boe01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   106295904
Exosome [BR:boe04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   106295904
  Exosomal proteins of breast cancer cells
   106295904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 106295904
NCBI-ProteinID: XP_013587368
UniProt: A0A0D3CFU4
Position
C5
AA seq 666 aa AA seqDB search
MAAAADHVVIVEEGRQATAEHPSAGPVYRCKYAKDGLLDLPADLDSPWQLFSEAVKQYPN
EQMLGRRVTVDSKVGPYTWITYREAHDAALRIGSAIRSRGVGPGNYCGIYGSNCPEWIIA
MEACMSQGITYVPLYDSLGVNAVEFIINHAEVSLVFVQEKALSSILACHKACSSNLKTIV
SFGEVSTTQKEEAENQCVSLFSWHEFLLMGNSDKTALPRKQKTDICTIMYTSGTTGEPKG
VILSNAAIMVEVLSIDKMLQVTDRSCDTSDVFFSYLPLAHCYDQVMEIYFLSRGSSVGYW
RGDIRYLMDDVHALKPTVFCGVPRVYDKLYAGVMQKISAGGLIRKKLFDLAYNYKLGNMR
KGLSQEEASPRLDRLMFDKIKDALGGRAHMLLSGAAPLPRHVEEFLRIIPASNLSQGYGL
TESCGGSFTTLAGVFSMVGTVGVPMPTVEARLVSVPEMGYEAFSGDVARGEICLRGKSMF
SGYHKRQDLTDQVVINGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLENTY
SRCPLIAQIWIYGNSFESFLVAVVVPERKAIEDWAKLNNQSSPSDFESLCQNLKAQKYFL
DELNSTAKQYQLKGFEMLKAVHLEPNLFDIERDLITPTFKLKRPQLLKHYKSIIDQLYTE
AKASRA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagctgctgatcatgtggtgatagtggaagaaggacggcaagccaccgcagag
catccatcggcaggaccggtttatcggtgtaaatatgctaaagatggcctcctcgacctt
cctgctgatcttgattctccttggcagctatttagtgaggctgtgaagcaatatccgaat
gagcaaatgttaggccggcgcgtaacggttgattctaaggtcggtccatacacatggatc
acatatagggaagctcacgatgctgcattgcggattggatcagcaatcagaagccgaggc
gttggtccgggaaactattgtggaatatacggatctaattgtccagaatggattatcgcg
atggaggcctgcatgagccaagggataacttatgtacctttatacgacagtttaggtgta
aacgctgtagagttcatcatcaaccatgccgaggtttcgctggtattcgttcaagagaag
gcactttcctccatcttagcatgccacaaggcatgttcttcgaatttgaagactattgtg
agctttggtgaagtctcgactacacaaaaggaagaagctgagaaccaatgtgtttcgtta
ttttcatggcatgagttcttactaatgggaaactcggataagacagcacttcctcgtaag
caaaaaacagacatatgcacaataatgtacacaagcgggacgacgggagagcccaaaggt
gtaatcttaagcaatgcagcgattatggtcgaagttttatccattgataaaatgcttcaa
gtcaccgatcgatcgtgtgacacaagtgatgtgtttttctcgtacttgccattagcacat
tgttatgatcaagtcatggagatctactttttatcaagaggctcgtctgttggatactgg
cgtggcgacattcggtacttgatggatgatgttcatgcactgaaaccaactgtgttttgc
ggtgttccacgagtttacgacaaactctatgctggtgtaatgcaaaaaatctcagctggt
ggtttgatacgcaagaaactgttcgatttggcttataactataaattggggaatatgagg
aaaggattgtctcaagaagaagcttctcctcgtctagacagacttatgttcgataagata
aaagatgcattaggaggaagagctcatatgttgttatcaggtgcagcacctttacctcgt
catgtagaggagtttttgagaatcatccctgcctctaatctctctcaaggttatggattg
actgagagctgtggagggagcttcacgactttagcaggagtattttctatggtggggaca
gtgggtgtgccaatgcctacggtggaggcaaggctagtttctgtaccagagatgggttat
gaagctttttccggggatgtggctagaggagagatttgtcttagaggaaaatcaatgttc
tctggttaccacaaaaggcaagacctaactgatcaagtcgtgatcaatggatggttccac
acaggagatattggggaatggcaagaagatggatcgatgaagatcatagataggaaaaag
aacatctttaagttgtctcaaggtgaatatgttgctgtcgaaaacctcgagaacacttac
tcaagatgccctcttattgctcagatatggatctatggaaacagcttcgagtcttttctg
gtagcagtggttgtacccgagagaaaggctattgaagattgggctaaacttaataaccaa
tcatctcccagtgattttgaatctctatgtcaaaatctcaaagctcaaaaatacttcttg
gatgagcttaactctaccgcaaagcaataccaacttaaagggtttgaaatgttaaaagcg
gttcatttggaaccaaaccttttcgatattgaaagagatcttataactccaactttcaag
ttgaaaaggccacagctcctgaaacattacaagagcataattgatcaactttacaccgaa
gcaaaggcgtccagagcatag

DBGET integrated database retrieval system