KEGG   Brassica oleracea (wild cabbage): 106296295Help
Entry
106296295         CDS       T04124                                 

Definition
(RefSeq) transcription factor bHLH122
Organism
boe  Brassica oleracea (wild cabbage)
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 106296295
NCBI-ProteinID: XP_013587853
UniProt: A0A0D3CPX9
Position
C6
AA seq 364 aa AA seqDB search
MESEFQQHHFLLHDHQHQRPPRTSGLVRYQSAPSSYFSSFGESIEEFLDRPTSPETERIL
SGFLQTTDTSNNVDSFLHHTFSETENKPPEVKTEEETVVDDIPPTATAMEVVEMAPPVST
GYASVVRSLGQNKRPRDDRTPANNLARHNSSPAGLFSSIDVETAYAAVMKNMGGFGVMNM
SNSTEASSLTPRSKLPPPSMGSIPEVDDVKPVFSSRLPPRTLSGGFNQGSASSKRMAIAR
TQSGGLDQYKTKDEDSSASRRPPLAHHMSLPKSLSDIEQLLSDSIPCKIRAKRGCATHPR
SIAERVRRTKISERMRKLQDLVPNMDTQTNTADMLDLAVQYIKDLQEQVKGLEESRARCR
CSCA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagagtttcagcaacaccacttccttctccacgatcaccaacaccagagaccg
ccaaggacctccggtttagttcggtaccagtcagctccaagctcgtacttctcgagcttc
ggtgaatccatcgaagagttcttggatcgaccgacaagccccgagactgagaggatcttg
tctggcttcttgcagaccaccgacacgagcaacaacgtcgacagcttcctccatcacacc
ttctccgagacggagaataagcctccggaggtgaagacagaggaggagacggtggttgat
gatattccgccgacggcaacggcgatggaggtcgtcgagatggctcctcctgtttcgact
gggtatgcttcggtggtgaggagtttaggtcagaacaagagaccaagagatgaccggact
ccggcgaataatctcgctcggcataacagctcaccggccgggttattctcatccatagac
gtggagacagcatatgcagctgtaatgaaaaatatgggaggttttggagtgatgaacatg
agtaatagtaccgaagcttcatctcttactccaagaagcaagcttcctcctccttccatg
ggctcaatccctgaggttgatgatgttaaacccgttttctcctcgaggttgcctcctagg
acgctctctggtgggtttaaccaaggctctgcttcgtctaagcgtatggcaattgcaagg
acacaatctggtggtctagatcagtacaaaaccaaggatgaagattcgtcagctagtaga
cgtcctcctttagcgcatcacatgagtttgcctaagtctttatcagatattgagcagtta
ctctcagattctatcccttgtaagatcagagctaaacgtggctgcgctactcatcctagg
agcattgctgagagagtgagaagaacaaagatcagtgaaagaatgaggaagctgcaagat
cttgttccaaacatggatacgcaaacaaacacagcagatatgttggatcttgcggttcag
tacatcaaggacctgcaagaacaagttaaggggctggaagagagccgggcaagatgtaga
tgctcttgtgcgtga

DBGET integrated database retrieval system