KEGG   Brassica oleracea (wild cabbage): 106298205Help
Entry
106298205         CDS       T04124                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like isoform X1
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00051  Fructose and mannose metabolism
boe00520  Amino sugar and nucleotide sugar metabolism
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
Module
boe_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106298205
   00520 Amino sugar and nucleotide sugar metabolism
    106298205
Enzymes [BR:boe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     106298205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3 DUF4954
Motif
Other DBs
NCBI-GeneID: 106298205
NCBI-ProteinID: XP_013589736
UniProt: A0A0D3D0R6
Position
C6
AA seq 415 aa AA seqDB search
MGSSMDEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQI
YLVGFYEEREFALYVSAISNELKVPVRYLREDKPHGSAGGLYHFRNLIMEDDPSHIFLLN
CDVCCSFPLPEMLEAHREYGGIGTLLVIKVSPELASQFGELVADPVTNELLHYTEKPETF
VSDRINCGVYVFTPDIFTAIRDVSSQTKDTATLRRVSSVEALQPATRNSTDFVRLDQDIL
SPLAGKKQLYTYETMDFWEQIKSPGMSLRCSELYLSQFRLTSPQVLASGDGTKSAIVIGD
VFIHPSAKVHPTAKIGPNVSISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSS
IGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSIVLPNKTLNVSVQDEIIL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggggagctcaatggatgagaaagtggttgctgtgatcatggtcggtggtccaaccaaa
ggtactcgattccgaccattgtccctgaatattccaaagcctctgtttcctattgcggga
caaccaatggtgcatcatccaatttcagcgtgtaaaaggattccaaacttagctcaaatc
tatcttgttggtttctatgaggaaagggagtttgcactttatgtctctgccatctccaac
gaactcaaagttcctgtcagatatctgagagaagacaagccacatggttctgctggtggt
ctgtatcactttagaaatctaatcatggaagatgacccgtctcatatcttcctgctcaac
tgtgatgtttgctgcagtttccccttgcctgaaatgctcgaggctcatcgggaatatggt
ggaattggaacacttcttgtgatcaaggtctctcctgaattagccagccagtttggagaa
ctggttgcggatccagttactaatgagctgcttcattacaccgagaaacctgaaactttt
gtcagtgaccgtattaactgcggtgtttatgtatttacacctgacatttttactgccata
agagatgtttcttctcaaacgaaagatacagcaactctgagacgtgtttccagcgttgaa
gctcttcaaccggcaacaaggaactccacggattttgtaagactggatcaagacatcctt
tcacctctagctgggaagaaacagctatatacttacgagactatggatttctgggagcaa
attaaatctcctggaatgtcgctgaggtgctcggaactctatctttctcaattcaggttg
acctcaccacaagtgctggctagtggtgatggaacaaagagtgccatagtgattggtgat
gttttcatacatccttctgcaaaagtacacccaactgccaagattggtcccaacgtctca
atctctgcaaatgctcgtgttggaccgggtgtcaggcttatcagctgtatcatccttgat
gacgttgagatcatggaaaatgcagtggtgactaacgcaattgttgggtggaaatcttct
atcgggagatggtcacgtgtccaggctgagggagtctacaactccaaactcggagttaca
attctcggagactcggttgcagttgaagacgaagttgtggtgaccagcagtatcgttctt
ccaaacaagacactcaacgtcagtgttcaagacgagatcatcttgtaa

DBGET integrated database retrieval system