KEGG   Brassica oleracea (wild cabbage): 106303578Help
Entry
106303578         CDS       T04124                                 

Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00020  Citrate cycle (TCA cycle)
boe00640  Propanoate metabolism
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106303578
   00640 Propanoate metabolism
    106303578
Enzymes [BR:boe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     106303578
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     106303578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 106303578
NCBI-ProteinID: XP_013595305
UniProt: A0A0D3DDD1
Position
C7
AA seq 345 aa AA seqDB search
MSRQVTRLLGSLPSKLRSSVSSSELYPSCSSLTSLTKSRSFGTTPPPPAAVFVDKNTRVI
CQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIY
VPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQTKTRLIGPNCPGIIKPG
ECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVDC
LEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGA
IVSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFELFQERGLLK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggcaagtcacgagacttctcggatctctcccttccaaactccgctcttccgta
tccagctcagagctatacccatcatgctcctctctcacttcgctgacaaagtctcgctcc
ttcggaacaacccctccgcctcccgccgccgtcttcgtcgacaaaaacacccgcgtcatc
tgccagggtataaccggaaagaacgggactttccacaccgaacaagccattgaatacggc
accaaaatggtagcgggagtgacaccgaagaagggtggaacagagcatttgggtcttcct
gttttcaataccgttgctgaagctaaggctgagactaaagccaatgcttctgtgatctat
gtgcccgcgcctttcgctgctgctgcgatcatggaaggtgtggctgctgagttggatctc
gttgtctgcattactgaagggattcctcaacatgacatggttcgtgtaaaggctgctctt
aacagtcagactaaaactaggctgattggtcctaactgccctgggattatcaaacctggc
gaatgcaagattgggatcatgccggggtacatccacaagccggggaagatagggattgtc
tctcggtctggtacattaacatatgaagctgttttccaaactagtgcagtaggactggga
caatctacgtgtgtaggaattggtggggatccttttaacggcacaaattttgttgactgc
ttggagaagttctttgttgaccctcaaacagaaggtatcgttctcattggagaaatcggt
ggtactgcagaagaagatgcagctgctttgataaaggaaagcggcacagataagcctgtg
gttgctttcattgctggactcactgcaccacctggtcgtcgaatgggtcacgctggagcc
attgtctctggtggtaagggaacggctcaagacaagataaagagcctaagagacgctgga
gtcaaggtggttgagtcaccggctaagattggtgcggcgatgtttgagcttttccaagaa
agaggtctcttgaagtag

DBGET integrated database retrieval system