KEGG   Brassica oleracea (wild cabbage): 106305850Help
Entry
106305850         CDS       T04124                                 

Definition
(RefSeq) magnesium protoporphyrin IX methyltransferase, chloroplastic
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00860  Porphyrin and chlorophyll metabolism
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    106305850
Enzymes [BR:boe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     106305850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_12 Methyltransf_31 Methyltransf_23 Methyltransf_11 MTS PrmA Methyltransf_18 CMAS TehB Methyltransf_32 Ubie_methyltran Methyltransf_4
Motif
Other DBs
NCBI-GeneID: 106305850
NCBI-ProteinID: XP_013597703
UniProt: A0A0D3DFZ4
Position
C7
AA seq 312 aa AA seqDB search
MPIAPSLLSPSSSVSHFLPRLPNATRLNVASRSRVATVVASSVTDLAGVDSTTIAVLGGG
SVAALATFVSLTDPERRRKLQAEEVGGGDKEVVREYFNSTGFERWRKIYGETDEVNRVQK
DIRVGHAKTVEKTMLMLTEEGSLAGVTVCDAGCGTGLLSIPLAKEGAIVSASDISAAMVA
EAETKAKQQLGGENLPRFEVNDLESLSGKYNTVVCLDVLIHYPQNKADGMIAHLASLAEK
RVILSFAPKTFYYDILKRIGELFPGPSKATRAYLHAEADVERALRKVGWKISKRGLITTQ
FYFSRLIEAVPM
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgccgattgctccttccttgttatcaccatcttcctccgtctctcactttcttcccaga
ctccccaacgccactagactcaatgtagcctcacggagcagagtcgccaccgtcgtggcg
tcatccgtcaccgacctagccggcgtggacagcacgactatcgccgtactcggaggcgga
tccgtcgcagctctggcgacgttcgtttcgctgacggatccggagaggaggcggaagctg
caggcggaggaggtcggaggaggagacaaggaggtggtgagggagtatttcaacagcacg
gggttcgagcggtggaggaagatctacggcgagactgacgaagtgaaccgcgtacagaag
gatattcgagtcggccacgccaagacggtggagaaaacgatgcttatgctgacggaggaa
ggatcgttggccggtgtcacggtgtgcgacgccggatgtgggaccggattgctctcgata
ccgcttgctaaggaaggggcgatcgtctctgctagcgatatctctgcagctatggttgct
gaagctgagacgaaggcaaagcagcagctaggaggagagaatctaccaagatttgaagtg
aatgatctagagagcctaagcgggaagtacaacacagttgtatgcctagacgtgctgata
cattaccctcagaacaaagcagacgggatgatcgcacaccttgcttccttagcagagaag
agagtgattctcagttttgcaccaaagacattctactatgatatcttaaagaggattgga
gagcttttcccaggtccctcaaaggctacaagggcctacctacacgctgaggcggatgta
gaaagagcattgcgtaaggttggctggaaaatcagcaagagaggactcattaccacccag
ttctatttttcgaggctcattgaagctgttcccatgtag

DBGET integrated database retrieval system