KEGG   Brassica oleracea (wild cabbage): 106306862Help
Entry
106306862         CDS       T04124                                 

Definition
(RefSeq) tyrosine decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00350  Tyrosine metabolism
boe00360  Phenylalanine metabolism
boe00380  Tryptophan metabolism
boe00901  Indole alkaloid biosynthesis
boe00950  Isoquinoline alkaloid biosynthesis
boe00965  Betalain biosynthesis
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106306862
   00360 Phenylalanine metabolism
    106306862
   00380 Tryptophan metabolism
    106306862
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    106306862
   00950 Isoquinoline alkaloid biosynthesis
    106306862
   00965 Betalain biosynthesis
    106306862
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    106306862
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:boe04147]
    106306862
Enzymes [BR:boe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     106306862
    4.1.1.105  L-tryptophan decarboxylase
     106306862
Exosome [BR:boe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106306862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 106306862
NCBI-ProteinID: XP_013599089
Position
C7
AA seq 495 aa AA seqDB search
MENGSSNKALKPMDSEQLREYGHRMVNFIADYYKTIETFPVLSQVQPGYLHNLLPDSAPE
QPETLEQVLDDVKEKILPGVTHWQSPSFFAYYPANSSVAGFLGEMLSAALNIVGFSWVSS
PAATELEMIVLDWFAKLLNLPEQFLSRGNGGGVIQGTASEAILVVMIAARDKVLRSLGKK
ALEKLVVYSSDQTHSSLQKACQLAGIHLENCRVLKTDSSTNYALRPESLQEAVSKDLEAG
LIPFFLCGTVGTTSSTAVDPLAALGKMAKSNEMWFHVDAAYAGSACICPEYRQYIDGVET
ADSFNMNAHKWFLTNFDCSLLWVKDRYALTEALSTNPEFLKNKASQANLVVDYKDWQIPL
GRRFRSLKLWMVLRLYGAETLKSYIRNHIKLAKDLQQLVSQDPNFEVVTPRIFSLVCFRI
AAVDNDDEKTCNNLNRSLLDAVNSSGKLFISHTSLSGKFVLRLAIGAPLTEEKHVMDAWK
VIQEEASFLLASQVK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggtagtagcaacaaggcgttgaagccgatggactcagagcaactgagagag
tacggacatcgaatggtcaatttcattgccgattattacaaaaccatcgagactttccct
gtccttagccaagttcagcctggttatcttcataatcttttgcctgattcagcaccagaa
caacctgaaaccctggaacaagttcttgacgatgtgaaggagaagatattgcctggagta
acgcattggcaaagccctagcttctttgcttattaccctgctaacagcagcgttgcaggg
ttcttgggtgagatgttgagtgctgctctcaatattgttggttttagttgggtatcttct
ccagctgccactgagctcgagatgatcgttcttgattggtttgccaaacttctcaacctg
ccagagcagtttctatccagaggaaatggaggtggagtcatccaagggacagctagtgaa
gctattcttgttgttatgattgctgcccgcgacaaggtcttaagaagccttggcaagaag
gcgcttgagaagctcgttgtctactcctctgaccagacacattcatctttacagaaagct
tgccagctagccggtatccatctagagaattgcagggtcctgaaaacagattcatctaca
aattacgctctgcgccctgaatcacttcaagaagctgtttctaaggatcttgaagctgga
ttgattccattcttcttatgtggcactgttggaacaacttcttcaacagcagttgatcca
ctagcagcactgggaaagatggcaaagagcaatgagatgtggtttcacgtggatgcagcg
tacgctggaagtgcttgtatatgtccagagtataggcagtacattgacggagtagaaact
gcagattcttttaacatgaatgctcacaaatggttcctcaccaacttcgattgttccctt
ctttgggtgaaggatcggtatgctctcactgaagctctttcaacaaatccagagtttctc
aaaaacaaggcttctcaagcaaacttggttgttgactacaaagattggcaaatccctctc
ggaagaagattcagatcattgaaactatggatggttttaaggctatatggagctgagacc
ttgaagagctatataagaaaccatatcaaactggctaaagatctccaacagcttgtctct
caagatcctaactttgaggttgtgactcctaggatcttttctctggtctgtttccgtata
gcagctgttgataacgacgatgaaaaaacatgcaacaacctaaaccgcagcctcctagac
gcagtgaactcttcagggaaactcttcatttctcacactagcttgtctggaaaattcgta
ctacgtttggccataggagcaccactgacggaggagaagcacgtgatggacgcatggaag
gttatccaggaagaagcatctttcttgcttgcttctcaagtaaaataa

DBGET integrated database retrieval system