KEGG   Brassica oleracea (wild cabbage): 106307105Help
Entry
106307105         CDS       T04124                                 

Definition
(RefSeq) probable nucleolar protein 5-1
  KO
K14565  nucleolar protein 58
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    106307105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:boe03009]
    106307105
Ribosome biogenesis [BR:boe03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    106307105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 106307105
NCBI-ProteinID: XP_013599427
UniProt: A0A0D3DCD8
Position
C7
AA seq 536 aa AA seqDB search
MLVLFETPGGFALFKVLDEGKLSNVEDLGNVFSSADSARKMVKLKAFDKFDNTSEALEAV
AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ
LSELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR
VREWYGWHFPELAKIISDNILYAKSVKLMGNRINAAKLDFSEILADEVEAELKEASVISM
GTEVSDLDLMHIRELCDQVLSLAEYRAQLYDYLKSRMNTIAPNLTALVGELVGARLISHG
GSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKYGLIYHASLVGQAPPKGKGKISRSL
AAKAALAIRCDALGDGEDNTMGVESRLKLEARLRALEGKDLGRLSGSAKGKPKIEVYDKD
KKSGSGGLITPAKTYNTAADSLLGQTSTAENGVKEKKDKKKKKKKAADAEEEEAKTEEPS
KKKSKKKKAEVEAEAEEPKAEEPSKKKKKRKHEEEETEMPAKKKEKKDKKKKKSEV
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtactgtttgagacacctggtggtttcgccctttttaaagtattagatgaagga
aagctatcaaacgttgaggatttgggcaatgtgttctcgtctgcagactcagcacgaaag
atggtgaagcttaaagcttttgacaagtttgacaacacctctgaagctcttgaagctgtg
gctaaattgctggagggagctcccagcaagggtctccgcaagtttctgaaagctaactgc
gaaggtgaaaccttagctgtggctgattcgaagcttggaaacattatcaaggagaaactg
aagatagattgtgtccacaacaatgctgttatggagctgttgcgtggtgtgagaagccag
ctttccgaacttatatctgggttaggtgatcaagacttggctccaatgagcttggggttg
tctcacagtcttgctagatataaactaaagttcagctctgacaaggttgatactatgatc
atccaagctattggtctgcttgatgatcttgacaaagagctcaacacttacgctatgagg
gttcgtgaatggtacggttggcattttcccgagcttgctaagatcatctctgacaatatc
ctttatgccaagtctgttaaattaatggggaatcggattaatgcagccaagctagacttc
tctgagatattggctgatgaagttgaagcagaactaaaagaagcttctgtgatatctatg
ggaactgaagtcagtgaccttgatttgatgcacatccgggaactctgcgaccaggtcctg
tccctcgccgagtacagagctcagctttatgactacttgaagagcaggatgaacacaatc
gcaccgaatctgaccgccctcgttggagagcttgtcggtgctcgtctaatttctcacggt
ggtagtttgttgaacctctcaaagcagcctggtagcacggttcagattcttggagctgag
aaagccctctttagagccctcaagaccaagcacgccactccgaaatacggtctaatctac
catgcttctttggttggccaagcgccaccgaagggcaagggtaaaatctcacggtcacta
gctgctaaagccgctcttgctatccgttgtgatgctcttggtgatggtgaagacaacact
atgggagtggaaagccgtttgaagcttgaggcacggttgagagctctggaaggaaaagac
ttaggacgtctgtctggctcagctaaaggcaaaccaaagattgaagtgtatgacaaggat
aagaagagtggatctggaggtcttatcactcctgctaagacttacaacactgctgcagac
tctcttcttggacaaacttccacagctgagaacggtgtcaaagagaagaaagataaaaag
aagaagaagaagaaggctgctgatgcagaggaagaagaagccaagaccgaggaaccgtct
aagaagaagtcgaagaagaagaaagcagaagtagaagctgaagcggaagagcccaaagca
gaggaaccttcaaagaagaagaagaagagaaaacacgaggaagaagaaacagaaatgcct
gccaagaagaaagaaaagaaggataagaagaaaaagaagagcgaggtctga

DBGET integrated database retrieval system