KEGG   Brassica oleracea (wild cabbage): 106311354Help
Entry
106311354         CDS       T04124                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03013  RNA transport
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    106311354
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:boe03012]
    106311354
Translation factors [BR:boe03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    106311354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI Sigma70_r4 DUF2779
Motif
Other DBs
NCBI-GeneID: 106311354
NCBI-ProteinID: XP_013604005
Position
C8
AA seq 895 aa AA seqDB search
MSRFFAQGGSDSEDESDIEEEIQEVQNNDINNRYLQDNSDDDDDIDTKRVIKPTKDKRFE
EMTHTVEQMKNAMKINDWVSLQENFDKVNKQLEKVMRITEAVKPPTLYIKTLVMLEDFLN
EALANKEAKKKMSPSNSKALNAMRQKLKKNNKLYEEDINKYREAPEVEEENEPEDEDDDD
EEDEDEFEDDDSKEAVTDEEVDETTDTRWETMLNKKDKQMEKLLSKDPKEITWDWVNQKF
KEIMAARGRKGTARFDLVDQLTHLTKIAKTPAQKLEILFSVISAQFDVNPGLSGHMPIKV
WKKCVLNMLTILDILVKYTNIVVDDTIEPDENETSKPADYDGTIRVWGNLVAFIERIDTE
FFKSLQSIDPHTREYVERLRDEPMFLALAQNIQDYFERMGDFKAAAKVALRRVESIYYKP
QEVYEAMRKLAELVEEDEEAEDAEEESGPISSFIVVPEVVPRKPTFPESGRAMMDLLVSL
IYRNGDERTKARAMLCDIYHHALMDNFGTARDLLLMSHLQDNIQHMVISTQILFNRTMAQ
LGLCAFRVGMITESHSCLSELYSGQRVRELLAQGVSQSRYHEKTPEQERMERRRQMPYHM
HINLELLEAVHLIGAMLLEVPNMAANSLEARRRVISKNFRRLLEISERQAFNAPPENVRD
HVMAATRALTKGDFQTAFEVLNSLEVWRMLKNRDSILEMVKARIKEEALRTYLFTYSSSY
ESLSLEQLAKMFDVTEAQVHSIVSKMMINEELHASWDQPTRCIVFHEVQHSRLQSLAFQL
TEKLSVLAESNERAMEARTGGGGLDLSSRRRDNNQDYAGAASGGGRWQDNNMNSGYGGRQ
GNNRSGYGGRPGQPRDWSGQNRGGGYAARAGSGNRGGMQMDGSTRMVSLNRGVRA
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgttttttcgctcagggtggtagtgacagcgaggatgagagcgatatcgaggaa
gagatccaggaggttcagaacaacgacatcaacaaccgttacctccaggataacagcgac
gacgacgacgacattgataccaaacgtgtcatcaagccaacgaaggacaagcgtttcgag
gagatgacgcacaccgttgagcagatgaagaacgctatgaagatcaacgattgggtcagc
cttcaggagaatttcgacaaggtcaacaaacagcttgagaaagttatgaggatcacggag
gctgttaagcctcctaccttgtacatcaagacgcttgtcatgttggaggatttcttgaac
gaggccttggctaataaggaagcgaagaagaagatgagtcctagcaactccaaggccttg
aacgcgatgaggcagaagctgaagaagaacaataagctgtacgaggaggatattaacaag
tatagggaggctccggaagttgaggaggagaatgagcccgaagatgaggatgatgacgat
gaggaagacgaggatgagtttgaggacgatgatagcaaagaggctgtgactgacgaggag
gtggatgaaaccactgatactcgctgggagacgatgcttaacaagaaagataagcagatg
gagaagctgcttagtaaagatcctaaggagatcacttgggattgggtcaaccagaagttt
aaagagattatggctgctcgtggtaggaaggggactgctcgttttgacctagttgatcag
cttacacacttgaccaagattgccaagactcctgctcagaagctcgaaatcttgtttagc
gttatctcagcacagtttgatgtgaatccaggtctcagcggacacatgcctatcaaggtc
tggaagaagtgcgtgctcaacatgctcaccatactggacatccttgtcaagtacactaac
attgttgtggatgatacaatcgagcctgatgagaatgaaacttccaagccagcagattat
gatggaacaatccgggtctgggggaatttggttgcgttcattgaaaggattgacactgag
tttttcaagagcttgcagtccattgatcctcacacccgtgagtatgttgagagactgagg
gatgagcccatgttcttggcccttgctcagaacatccaagactactttgagcggatgggt
gatttcaaagctgctgcaaaggtggccttgagacgagttgagtcaatatactacaagccc
caggaagtttatgaggctatgaggaagctggctgagttggttgaagaagatgaagaagct
gaggatgccgaagaggaaagtggacctatttcttcattcattgttgttccagaggttgtt
ccccgtaaacctaccttcccagagagcggccgagcaatgatggatcttcttgtgtccctt
atctacagaaatggagatgagcggaccaaggcccgtgcaatgctatgtgatatctatcac
catgctttgatggacaactttgggactgctagagacttgttgctaatgagtcatctccaa
gacaacattcagcacatggtcatctcaacacagattctctttaacaggaccatggcgcag
cttggtctttgtgccttccgtgttggaatgatcactgagtcccatagctgcctctccgag
ctgtactctggtcagagagtgagggagttgcttgcccaaggtgtctcgcaaagtcgatat
catgagaagacacccgaacaggaaaggatggagaggagaagacaaatgccataccacatg
cacataaacctcgagctactggaggctgttcatctcatcggtgccatgctacttgaagtc
ccaaacatggcagcaaactcgcttgaagccagacgcagagtgatcagcaagaatttccgt
cgcctgcttgagatcagcgagaggcaagcgttcaatgcaccacctgagaatgtacgtgat
cacgtcatggcagctaccagagccctgaccaaaggggatttccagaccgcgtttgaggtt
ctgaactctcttgaggtctggagaatgctcaagaaccgtgacagcatcctcgaaatggtc
aaagctaggatcaaagaagaagctctaaggacttacctattcacttactcgagctcctat
gagtccctaagccttgaacagctggctaagatgtttgatgtcaccgaagcacaggttcac
agcattgtgagcaaaatgatgatcaacgaagagcttcacgcaagctgggaccagccaaca
cgatgcattgtcttccatgaagtgcaacacagcagattacagtctttggctttccagtta
accgagaaactatcagttttggcagaaagtaacgaaagggcaatggaagcaagaaccggt
ggaggtggtctggatctgagctcaaggaggagagacaacaatcaggactatgcaggagca
gcatcaggtggtgggagatggcaggacaacaacatgaattctggatatggaggaagacaa
ggtaacaacagatctgggtatggaggaagaccaggacagcctagagactggtcgggccag
aaccgaggtggaggatatgcagcaagagctggctcaggaaacagaggtggtatgcaaatg
gatggctcaactcgtatggtgagtcttaaccgaggtgttcgcgcttag

DBGET integrated database retrieval system