KEGG   Brassica oleracea (wild cabbage): 106311639Help
Entry
106311639         CDS       T04124                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 2-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00520  Amino sugar and nucleotide sugar metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    106311639
Enzymes [BR:boe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     106311639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd
Motif
Other DBs
NCBI-GeneID: 106311639
NCBI-ProteinID: XP_013604332
UniProt: A0A0D3DV66
Position
C8
AA seq 106 aa AA seqDB search
MRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNASIEFRPNTEDDPHKRKPDITKAK
ELLGWEPKVSLRQGLPLMVKDFRQRVFGDQKEGSSMATTTTKTTSA
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgagattgatggaaggagaacatgtcgggccatttaacctgggtaaccctggtgaattc
accatgctcgagctcgctaaggtggttcaagagacgattgatccaaacgcaagcatagag
ttcagaccaaacacagaagatgaccctcacaagagaaagcctgacatcacaaaggccaaa
gagcttttaggatgggaacctaaggtgtctcttcgtcagggactccctctcatggtcaaa
gacttccgtcaacgtgtctttggtgaccagaaggaaggctcctccatggctacaaccacc
accaaaacaacctcagcttga

DBGET integrated database retrieval system