KEGG   Brassica oleracea (wild cabbage): 106312044Help
Entry
106312044         CDS       T04124                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00010  Glycolysis / Gluconeogenesis
boe00562  Inositol phosphate metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106312044
   00562 Inositol phosphate metabolism
    106312044
Enzymes [BR:boe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106312044
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106312044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 106312044
NCBI-ProteinID: XP_013604869
Position
C8
AA seq 478 aa AA seqDB search
MAMKSVWIILLCLFVIAEADQGFDVRHHLSTVTRYSASKEVSQNLIEGSNVPSECTPIHL
NLVARHGTRSPTKKRLRELENLSGRLKELVRDAEASDKVPGWLGKWISPWKGKVKGGELI
RQGEEELYQLGIRVRERFPTLFEEDYHPDVYTIRATQIPRASASAVAFGMGFFSEKGDLG
PGSNRAFAVTSENRASDTKLRFFECCQNYKSYRKAKGPAVDMLKEPVLDKITASVAKRHG
LNFTKQDVSSLWFLCKQEASLLNVTNQSCELFTPSEVALLEWADDLEVFILKGYGNSLNY
RMGVPLLEDVFYSMEEAIKAREDKLPPGSYEKARLRFAHAETIVPFSCLLGLFLDGSEYE
KIQKEKPLELPPQPPKTRDFRGSTMAPFGGNNMLVLYSCPAASSPKYFVQVLHNEHPIAL
PGCDGKDFCPLEDFKAKVVTPHLKHAFDNLCNANLDDPKQEHQSLWSWLLGSSQKTEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaagagtgtttggatcatactgctctgtttattcgttatcgcagaggcagat
caaggcttcgatgttcgtcatcacttatccaccgtcaccagatactcagcttcaaaagaa
gtctctcaaaatctgattgaagggtcaaatgtccccagtgagtgtacacctatccacctt
aaccttgtggctaggcatggaactcgttctccaaccaagaaaaggttacgggaactagaa
aatttatccggtaggctaaaggaactggtaagagacgcagaagcttcagataaagttcct
ggatggttagggaaatggatatctccatggaaaggcaaagtgaaaggcggtgagctgatc
aggcaaggagaggaggagctgtaccagcttgggatcagggttagggaacggttccccact
ttgttcgaagaggattatcaccctgatgtttataccattagagctacacagattcctcgg
gcatctgcaagtgctgtggcgtttggaatgggatttttcagtgagaaaggagacttggga
cctgggagtaatagagcgtttgctgtcactagtgagaaccgtgctagtgataccaagcta
agattctttgaatgttgtcaaaactacaagagctataggaaagctaaagggcctgctgtg
gatatgctcaaggagcctgttcttgataagatcacagcttccgtagcaaagagacatggt
ttaaatttcactaaacaagacgtttcttctctctggtttctatgcaagcaggaagcatca
ttgcttaatgtaactaatcaaagttgtgaacttttcactccatctgaggttgctttgctg
gaatgggcagatgacttggaagtgtttattctcaaaggttatggaaactccttgaactac
agaatgggagttccgttgctagaagatgttttttattcgatggaagaagctatcaaggct
cgagaagacaagctcccacctggaagctacgaaaaagcaagactgaggtttgcacacgct
gagacaatagttcccttctcttgtcttcttggacttttccttgatggatctgagtatgag
aagatacagaaggagaaaccactggaactccctccacagcctcctaagaccagggacttt
agaggcagcaccatggctccttttggtgggaacaacatgcttgtcctctacagttgtcct
gcagcttcctctcccaagtactttgttcaggttctgcacaacgagcatcctattgcactt
ccaggttgtgatggaaaagacttctgtcctcttgaagatttcaaggccaaagtggtgact
cctcatctcaagcatgcttttgacaacctctgcaatgctaatttagacgaccctaaacag
gagcatcaatctctgtggagttggctgttggggtcaagccaaaaaaccgagctctaa

DBGET integrated database retrieval system