KEGG   Brassica oleracea (wild cabbage): 106312120Help
Entry
106312120         CDS       T04124                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00260  Glycine, serine and threonine metabolism
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106312120
Enzymes [BR:boe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     106312120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_3 Pyridoxal_deC OKR_DC_1 HeH
Motif
Other DBs
NCBI-GeneID: 106312120
NCBI-ProteinID: XP_013604965
UniProt: A0A0D3DYE0
Position
C8
AA seq 358 aa AA seqDB search
MVMRTVDIRSDTVTRPTDAMREAMGSAEVDDDVLGYDPTARRLEEEIAKMMGKEAALFVP
SGTMGNLICVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLGA
IEAAIRDPKGSTFYPSTRLICLENTHANSGGRCLSVEYTDRVGEMAKRHGLKLHIDGARI
FNASIALGVPVHRLVQAADSVSVCLSKGLGAPIGSVVVGSQSFIEKAKTLRKTLGGGMRQ
IGVLCAAALVALQENLPKLQFDHKKTKLLAEGLNQMKGIRVNVTAVETNMLFMDMEDGSK
LTAEKLRKSLTEHGIHVIPENSSRIRMVIHHQITTSDVHYTLSCLQQAVQMIQEPSRN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgcgaactgtggatatacggtcagacaccgtgactagaccaactgatgcgatg
cgtgaagcaatgggaagcgcagaagtagacgatgacgtcctcggctacgacccaacggct
cgacgtcttgaagaggagatagccaagatgatggggaaagaagcggctctcttcgtgcca
tctggtacaatggggaatctcatatgcgttatggtccactgcgacgtgagaggcagcgag
gtgattcttggcgacaactgtcacatccatgtttacgagaatggagggatatcaacgata
ggaggcgtgcatcccaagacaatcaagaatgaagaagacgggacaatggacttgggggct
atagaagcagctattagagaccctaaaggaagcacgttttatccatcaacaaggttgatt
tgcttggagaacacacacgccaactccggtgggagatgtttgagcgtggaatatacagat
agagttggagagatggcgaagagacatggtttaaagcttcatatcgatggagctcgcatt
tttaatgcttccattgcacttggagttccagtccataggcttgtacaggctgctgactct
gtttcggtgtgtctctctaaaggtcttggagctccgataggatctgtagtcgttgggtca
cagagtttcatagaaaaggcaaaaacgttaagaaaaacattaggtggaggaatgagacaa
ataggcgtcctgtgtgcagccgctttggtcgcacttcaagagaatctcccaaagttacaa
tttgaccacaagaagacaaagttgttagctgaagggttgaatcaaatgaaagggattaga
gtgaacgttacagccgtggagaccaacatgttattcatggatatggaggatggatcaaaa
cttaccgctgagaaactgcgcaagagtttaactgaacatggcattcatgtcatcccggaa
aactcgtcccggatcagaatggttatacaccaccagataacaacaagtgatgtgcattac
acattgtcttgcttacaacaagcagtgcaaatgattcaggaaccaagccggaactga

DBGET integrated database retrieval system