KEGG   Brassica oleracea (wild cabbage): 106312382Help
Entry
106312382         CDS       T04124                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00450  Selenocompound metabolism
boe00970  Aminoacyl-tRNA biosynthesis
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    106312382
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106312382
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:boe01007]
    106312382
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:boe03016]
    106312382
Enzymes [BR:boe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     106312382
Amino acid related enzymes [BR:boe01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   106312382
Transfer RNA biogenesis [BR:boe03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    106312382
 Prokaryotic type
   Other AARSs
    106312382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 Flavodoxin_2
Motif
Other DBs
NCBI-GeneID: 106312382
NCBI-ProteinID: XP_013605341
UniProt: A0A0D3DTB7
Position
C8
AA seq 609 aa AA seqDB search
MAARLNTSLQNTLSLLNPFNTLLTKKPFSSRNSFRFSKKLPSSPRRALYCTSTLESHDNA
ETFVLTTPLYYVNAPPHMGSAYTTIAADSIARFQRLLGKKVIFITGTDEHGEKIATSAAA
NGRNPSEHCDLISQSYRTLWKELDIAYDKFVRTTDPKHEAIVKEFYDRVFANGDIYRADY
EGLYCVNCEEYKDEKELLENNCCPVHQMPCVARKEDNYFFALSKYQKPLEEVLSQNPRFV
QPSYRLNEVQTWIKSGLRDFSISRALVDWGIPVPNDDKQTIYVWFDALLGYISALTEDNE
QQNLDTAVSLGWPASLHLIGKDILRFHAVYWPAMLMSAGLNLPKMVFGHGFLTKDGMKMG
KSLGNTLEPFELVQKFGPDAVRYFFIREVEFGNDGDYSEDRFIKIVNAHLANTIGNLLNR
TLGLLKKNCESTLVVDSTIAAEGVPLKDTVEKLVEKARTNYESLSLSTACEAVLEIGNAG
NSYMDQRAPWMLFKQGGVSAEAAAKDLVIILEVMRIIAVALSPIAPCLSLKIYSQLGFSV
DQFNSITWDDTKWGELKEGQVMAQASPVFVRIELDAAEKDEEEKKPKDSKKKGKAKVKAE
QQPQTIAEA
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaggttaaacacttcgcttcaaaacaccctctctttgttaaacccatttaat
actctcctcactaagaaaccattctcttcgagaaacagcttcagattctccaaaaagctc
ccttcttccccgaggagagctctctactgtacttccaccctcgaaagccatgacaacgcc
gagactttcgtcctcaccaccccgctttattacgtaaatgcccctccccacatgggcagc
gcttacaccaccatcgccgccgattcaatcgcccgtttccagaggctgcttggcaagaag
gttatctttatcaccggaacagatgagcatggtgagaagatagctacctcagcagctgct
aacggacgcaacccttccgagcattgtgatctcatttctcagtcttatcgaactctttgg
aaagaactcgatatagcttatgataagttcgtcagaaccactgatcctaagcatgaagct
atcgtgaaagagttctatgatcgagttttcgcgaacggggatatatacagagctgattat
gaaggtctttactgtgttaactgtgaggaatataaggatgagaaagagctgcttgaaaac
aattgttgccctgttcatcaaatgccatgtgttgccaggaaagaagataactacttcttt
gctctatcgaaatatcagaaacctcttgaagaagttttgtctcagaatcctcgtttcgtg
cagccttcctaccgtctaaacgaggtgcaaacatggataaagagtggcttaagggatttt
tcaatttctcgagcattagtagattgggggattcctgttcctaatgacgacaagcaaacc
atatatgtttggtttgacgctctactaggttacatatcagctctaacagaggacaatgag
caacaaaatctagacactgccgtttcattaggctggcctgcttcattgcatttgattggg
aaggatattctaaggtttcacgctgtctattggcctgctatgctaatgtctgctggtctg
aaccttccaaagatggtgtttggtcatggatttctcacaaaggatggaatgaagatgggg
aaatcgttggggaacactctagaaccttttgagctggttcagaaatttggaccagatgct
gttaggtacttcttcatccgggaggttgaatttggaaacgatggggactactcagaagac
cgttttataaaaattgtcaatgcacatctcgccaacacaataggaaacctcctaaaccgt
actcttggccttctcaagaagaactgtgagtccactttagtagtagattccaccattgca
gccgaaggagttcctttgaaagacacagtagagaagctggttgaaaaggcacggacaaac
tatgagagcctgtcattatcaacggcgtgtgaggctgtgttagagattgggaatgcggga
aactcctacatggatcaaagagcaccttggatgcttttcaaacaaggtggtgtctcagca
gaagctgcagccaaggatctggtgattatactggaagtaatgagaatcatagcggttgcg
ttatcccccattgctccttgtttaagcctgaagatatattcacagcttgggttctcagtt
gatcagttcaatagcataacatgggatgataccaagtggggagagctaaaggaaggtcaa
gttatggcgcaagctagtcctgtttttgtaagaatcgagctggatgcagcagagaaagat
gaagaggagaagaagccaaaggatagtaagaaaaagggtaaagctaaggtcaaagcagag
cagcaacctcagactatagcagaagcttaa

DBGET integrated database retrieval system