KEGG   Brassica oleracea (wild cabbage): 106312680Help
Entry
106312680         CDS       T04124                                 

Definition
(RefSeq) Fanconi anemia group D2 protein homolog
  KO
K10891  fanconi anemia group D2 protein
Organism
boe  Brassica oleracea (wild cabbage)
Brite
KEGG Orthology (KO) [BR:boe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:boe03400]
    106312680
DNA repair and recombination proteins [BR:boe03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     106312680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2 ANAPC8
Motif
Other DBs
NCBI-GeneID: 106312680
NCBI-ProteinID: XP_013605740
UniProt: A0A0D3DLW2
Position
C8
AA seq 1475 aa AA seqDB search
MVFLSRKKPPPPPPSSSSAPPPKFPQPQKKSTDEPDAVEKMTAILAEAGCTLNNPYGPPC
LPSDLHAFRRHLTTRFSSCSAERDSVSDLRSVFVAGFSSYVQSPSNLRRVLSTCSSTKRD
DSLVRNLLLVSPIQLDLQETLLEKLPEYFDVVSGCSLEEDVARLIINHFRWLDFIANPDV
FTDKLMEVLSISPPHLKKEIIGSLPEIIGDHISRAVVDSLEKMLQEDSSVVVPVLDSFSN
LNLDDQLQEQALTVAISCIRTIDAEHMPYLLRFLLLAATQANVRRIISQIRQQLKFTGIS
QPCASQNKLKGKAPAYNSEGSILHALRSSLRFKNILCQEIIKDLNGLEKPRDFKVIDIWL
LILMYMNGDPIRKSIEKIFKKKVVDGCIQEALLDQCICGNKEFVKDNFGSFISLAEHLLS
SKEEKAREFGSHIYTRLFEGFADNYSRQEILGALVTHVGSDNKFEVSSVLEMMTVLVKKY
AQQLLPFSSHINGILDYLEGFTVENLHKVYEVFSLLALSARASPDSFRSSVSNELMMIVR
KQISHPELKYQKMGLVGTLRIVSSLGDATSVPDCSSSQVSDCGEILELLKTSVDSCRQSN
LALIIFYDEFAAILNQKLLQPEIMEWIGKHLGEFESLFLADLDNGEMANKSSYSGLEGDL
WMNLDGSISPICLNILALASSSSESCCLQILPSNFLLLSSVERLTNGGSLAGIDALLGCP
LHLPSSKYFAAAGWQSLTKKQREILSLSLYYAANWIRELLNAFSSQIDKRDGCISQATEK
DVTTKLLMRLRNLIFLESLLNNLITLSPQSLPELHPYSATSQHTEHPERKNEKRKLQDDD
ASQRKGNMKNKFKKSKQPSVDEHLRQPTILDAFKKAGVVTSQTQLHENPSPSSLDGRIAS
GSMHETCSGDESLSVKIPQLSPALAAQRFKFRPLLPQCLSILKFPKVQSQNIRNPEYKTE
LPLYLYLLQDLHTKLDSLVPPGKLLPFKRGSPPGNLGRFKLVELVSQIKGLFPSLRMHLN
TAMSLLIKGEETSQTIWRDEFAKAGNPNTSNIVVSDSLIYTMVCKEVLLCFSKMLTLPGF
ETDKSLLLDLLEAFQPTDIPVDSFADLQPFPSPGTKDYLFIGVYCFFEDILNNACSFSFD
LAFECLLTLQLVVTSAQKYIGKVSEEVIKKRCVGPIQGLVPSLHAKLGTSAEKLLRHEWI
DETTDNKGLKNKCEMVQNILRIYLETSGSTSDLLDELACTILPQASLSKSTGEDDAHDHE
FPTLCSATFRGWYKTLHEENLAILNKLVKVVSSEKRQNCQSEATEAHLRDIQKTVNVIVS
LVNLCRSHDKVTIHGMAIKYGGKYVDSFLKVFDFLEAHIQDHNELVIQLVKDLQKATRTL
QTLCSEAKGMKQTAITSKIPATKRSLERFLFHVKALLHTTSRGSNFWMGSLKHKDLRGQI
VSSQAYVDNETDEVEEETMSGGEDPMEADELPLSP
NT seq 4428 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctctcgcaaaaagcctccaccgcctccgccatcttcctcatctgctccg
cctcccaaattcccccagccgcaaaagaaatccaccgatgaacccgacgcggtggagaag
atgactgcgattctagcggaagctggctgcacactgaacaacccgtacggtcctccatgt
ctcccctccgatctccacgccttccgccgccatctcacgactcgcttttcgtcttgctcc
gccgagagagatagcgtcagtgatctccgctcagttttcgtagctggattctcatcgtac
gttcaatctccgagtaatcttcgtagagtactttccacttgttcatcaacaaagagagac
gactcattagtccgtaacctcctccttgtgtctcccatccaacttgatctacaagaaacg
cttctcgagaagcttccggagtacttcgacgtcgtttctggatgttcccttgaggaggat
gttgctcgcctcatcatcaatcatttccgttggctcgacttcattgctaatcccgatgtg
ttcaccgataagctgatggaagttctatcgatctctcctccgcacttgaagaaggagatc
attggatcgttgccggagattattggggatcacatctctcgtgctgtggttgattctcta
gagaagatgcttcaggaggattcttctgttgttgttccagttcttgattctttctctaac
ctcaatttagatgatcaattgcaagaacaggcgcttacagtagcgatatcatgtattaga
acaatcgacgcagagcatatgccgtatctacttaggttcttgcttcttgctgctactcaa
gcaaatgttagaagaataatctcccagatacgccaacagttgaagttcaccggaatctca
caaccttgtgcttctcaaaacaaactcaaaggaaaagcacctgcatataattcagaaggt
tctattctccatgctttgagatcaagccttcggtttaagaatatactctgtcaagaaatc
ataaaggacctgaatggtctggagaaacctcgagatttcaaggtaatcgatatatggctg
cttattctcatgtatatgaatggggatcccatcaggaagagcatcgagaagatatttaag
aagaaagtggttgatggatgcatacaagaagccttgcttgatcaatgtatatgtggcaat
aaagagtttgtgaaggataattttggatcgtttatttctttggctgaacacctcttgtca
agcaaagaagaaaaagcaagggagtttggctcgcatatctatactcgtctttttgaagga
tttgctgacaattattccagacaagagatactaggtgccctagtgacacatgtgggatct
gataacaaatttgaggtcagttcagtcctagagatgatgacggttctggtgaaaaaatat
gcacagcaactccttcccttttcttctcacataaatggtattttggactacttggaggga
tttaccgtggaaaatttgcataaggtctatgaggttttcagtctcctcgcactatcagct
cgtgcaagtcctgattcttttcgatcttcagtttcgaatgaacttatgatgatagtaagg
aagcagattagtcatccagagctcaagtaccaaaagatgggattagttggaactctaagg
attgtttcatcacttggggatgcaaccagtgttccggactgttcatcatctcaggtttca
gattgtggggagattttggagctcttaaagacatctgtagactcttgcagacagtctaac
ttagccctaattattttctatgatgagttcgctgccattctcaaccagaaactacttcag
ccagaaattatggagtggattgggaagcatctgggagaatttgagtcactatttctggcc
gatcttgacaacggagaaatggctaataagagttcatattctggactagaaggggatctt
tggatgaacttggatggtagtatatcaccaatctgtttgaacattttggccctggcatct
tcatcctcagagtcttgttgtctgcagattcttccttcaaattttcttttgctatcatct
gttgagaggttgacaaatggtggatcccttgctggaattgatgctctgctcggatgccct
ttgcaccttccttcttccaagtactttgctgcagctggatggcaatctctgacaaaaaag
cagagagaaattctctctctctctttatattatgctgcaaactggatacgagaactcctt
aacgccttcagttcccaaattgacaaaagggatggctgcattagtcaggctacagaaaag
gatgtgacaacaaagcttctgatgcgactcagaaatctaatattcttggaaagcttattg
aacaatttgattacgctatctcctcagtctctaccggagctccacccttattcagccaca
agtcaacatactgagcatccagagaggaaaaatgagaagaggaaactacaagatgatgat
gcttcccaacgcaagggaaacatgaaaaataaattcaaaaaatcaaagcagccaagtgtt
gatgaacacttgcgacagccaactattttggacgctttcaagaaagcaggagtagttacg
agtcaaacacagctacatgaaaatccttccccttcatcgttagatggcaggatagcgtca
gggtcaatgcatgaaacttgttctggtgatgaatctctaagtgtaaagattcctcaactt
tccccggcccttgcagcccaaagattcaaattcaggcctcttcttcctcaatgcctttcc
atcctaaaatttccaaaggtgcagagccaaaatatacgaaaccctgaatataaaactgag
ctacccctgtatttgtatctcttacaagatcttcataccaagctggatagtcttgttcct
cctggtaaactacttcctttcaaacgtggaagccctccaggaaatttagggaggttcaaa
ttggttgaacttgtcagtcaaataaaaggactttttccaagcctcaggatgcatttgaat
acagcaatgtccttactgataaaaggtgaggaaacttctcaaactatttggagagatgag
tttgctaaggcgggaaatccgaacacatccaatatagtagtgtctgattctctgatttac
acaatggtgtgcaaagaagttttattatgtttcagcaagatgttgaccctccctgggttc
gaaacagacaaatcgctgctactggatcttctggaagccttccagcccaccgacattcca
gttgatagcttcgcggatctgcaacctttcccttcacctggaacaaaggactacttgttt
attggcgtctattgtttctttgaagatattttaaacaacgcttgttctttctcgtttgat
ctggccttcgaatgtcttctaactctacagttagtggtgacctcagcacaaaaatatatt
ggtaaggtatctgaagaagttattaagaagagatgtgtaggtcccattcagggtcttgta
cccagcctgcatgccaaactgggaacttcggctgagaaacttctcaggcatgaatggatt
gatgaaactactgataacaagggtttgaagaacaaatgtgaaatggtgcagaacatattg
cgaatatacctggaaaccagtggatccacatctgatttgctcgatgaacttgcttgtacc
attttgcctcaggcctctctatccaagtcaacaggagaagatgatgctcatgatcatgaa
ttccctacactatgttcagcgactttcagaggatggtacaagacattgcatgaagaaaat
ctcgcaattctcaacaaactggtgaaggttgttagctcagagaaacggcaaaactgtcaa
tctgaagctaccgaagcacacttaagagacattcagaagactgtaaatgtgatagtgtct
ttagtcaacttgtgtcgctcgcatgataaggttacaatccacggaatggctatcaagtat
ggtgggaagtatgtggactcatttctaaaagtttttgatttcctggaagcacatattcaa
gatcataacgaattagtcatccagctggtcaaagatctccaaaaggctacaagaacatta
cagactctatgttctgaagctaagggtatgaaacaaacagccatcaccagcaaaatacca
gcaacgaagcgatctttagagcgctttctgtttcacgtgaaggctcttctccatacaacg
tcacgcggctccaacttctggatgggtagcttgaaacacaaggacttgagaggacaaata
gtgagttctcaggcttatgtagataacgaaacagatgaggtagaagaagaaaccatgtcc
ggaggagaagatcccatggaagcggatgaacttcccttgtcaccttaa

DBGET integrated database retrieval system