KEGG   Brassica oleracea (wild cabbage): 106312958Help
Entry
106312958         CDS       T04124                                 

Definition
(RefSeq) protein tipD
  KO
K17890  autophagy-related protein 16-1
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:boe00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    106312958
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:boe04131]
    106312958
   03029 Mitochondrial biogenesis [BR:boe03029]
    106312958
Membrane trafficking [BR:boe04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    106312958
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    106312958
Mitochondrial biogenesis [BR:boe03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    106312958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 Ge1_WD40 PQQ_2 Cytochrom_D1 DUF4349
Motif
Other DBs
NCBI-GeneID: 106312958
NCBI-ProteinID: XP_013606123
UniProt: A0A0D3E9Q1
Position
C9
AA seq 509 aa AA seqDB search
MSQEEKAMEAIKDALRALRKRHLLEEGAHGPAISALSKPMISQGSEWKEKTEKLEIELQQ
CYKAQSRLSDQLVIEVAESRTSKASLQDKELLINDLEKDLSQTREECTRLQEELEEKTKT
LDLLITENKEVRSQLEEMTNRAQKAESENKMLIDRWMLQKMQDAERLNEANALYEEMLAK
LKANGLENLARQQVDGIVRRNEDGTDHFVESTIPSTCGHRIHAHEGGCGSILFQYNSRTL
FTGGQAGPVKMWDTNSGSLIKSLNGSLGNILDLAITHDNKSLIAASSSNNLFVWDVNSGR
VRHTLTGHTDKVCAVDVSKFSSRHVVSAAYDRTIKLWDLQKGYCTNTVLFTSNCNAICLS
IDGLTVFSGHMDGNLRLWDIQTGKLLSEVAGHSSAITSVSLSRNGNMILTSGRDNVHNVF
DTRTLEICGTLRASGNRLASNWSRSCISPDDEYVAAGSADGTVHVWSISKGSIVSTLKEQ
TSPILCCSWSGIGKPLASADKNGYVCTWT
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggaggagaaagcaatggaagccataaaagacgctttgagagctttgcggaag
cgccatcttctggaagaaggagctcatggacccgccatttctgcgctctctaaacctatg
atttctcagggatctgaatggaaggagaaaacagaaaagctggagatagagctacagcag
tgttacaaagcgcaatcccgattgtctgatcaactcgtgatagaagtagctgaatccaga
acttcaaaggcttctttacaagacaaggagttgttgattaatgacctcgagaaggactta
tcccaaacaagggaggagtgtacacgattacaagaagagttagaggaaaagaccaagacg
cttgatttacttattaccgaaaacaaggaagtcagatctcagctggaggagatgactaac
agagctcaaaaagcagagtctgagaacaaaatgttaattgatcggtggatgttacagaag
atgcaggatgcagaacgtcttaatgaggcaaatgctctctatgaagaaatgctagctaag
cttaaggccaatggtttggaaaatcttgctaggcagcaagttgatggaattgtccgacgc
aatgaagatggaactgatcattttgttgagtctaccatcccgtcaacatgtggccaccgt
atccatgctcacgaaggtggctgtggttcgatactctttcaatacaactctcgtactctg
tttaccggtggccaagccggaccagtaaaaatgtgggacaccaatagtgggtctctaatc
aaaagcttaaacggttcccttgggaatatacttgatctagccataacccacgacaataag
tccctgatcgcagcaagcagctctaacaatttgtttgtgtgggacgttaactctggtagg
gtacgtcatactctcacaggccacacagataaagtatgtgctgtggatgtgagcaagttc
tccagccgacatgttgtcagtgcagcttatgaccgtactattaaactctgggatttgcag
aaaggttactgtacaaacacagtgctctttaccagtaactgcaatgcgatctgcttaagc
atagatgggcttacggtattctcaggccacatggatgggaatctgaggttgtgggatatt
caaactgggaaacttctgtctgaagtagctggacattcttctgctataacctctgtatca
ttgtcccggaatggaaatatgatcttgacgagcgggagagacaacgtgcataatgtattc
gatacacggactttggaaatttgcgggacgttgagagcatcagggaacagattggcatcg
aattggagccggtcgtgtataagtccagatgatgaatacgtggctgcgggatctgctgat
ggaacggtgcatgtctggtctatctccaaaggcagtatagtgagcactctcaaggagcaa
acatctcctatactgtgttgttcttggagtgggattgggaaaccattggcatcggctgat
aaaaacgggtatgtctgtacttggacatga

DBGET integrated database retrieval system