KEGG   Brassica oleracea (wild cabbage): 106313046Help
Entry
106313046         CDS       T04124                                 

Definition
(RefSeq) acid beta-fructofuranosidase 3, vacuolar isoform X1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00052  Galactose metabolism
boe00500  Starch and sucrose metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106313046
   00500 Starch and sucrose metabolism
    106313046
Enzymes [BR:boe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106313046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 106313046
NCBI-ProteinID: XP_013606220
Position
C9
AA seq 654 aa AA seqDB search
MASSESLLPVSSQQDPLSGSRCDSIPESRRRRPIKVHLAIYSGFLLIALYVTLVITHGGS
APKNDVNDDTTVESRARLAGVSEKSNDHIWNLSNDLKGEAFAWNNTVLSWQRTAFHFQPE
KNWMNDPNGPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPFAMVPDQWYD
ANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLAYPEDPKDPLLLKWTKFSGNPVLVPP
PGIGAKDFRDPTTAWKTSDGKWRIIIGSKINRTGISLIYDTTDFKTYEKHETLLHQVPNT
GMWECVDFYPVSKTKDKGLDTSVNGPDVKHIIKASMDDTRIDHYAIGTYYDSNATWVPDN
PSIDVGISTGLRYDYGKFYASKTFYDQHKGRRILWGWIGESDSEAADVQKDWSSVQGIPR
TVALDTKTGKNLVQWPVKEIESLRLRSKKFHMKVEPGTVVPVDVGPTAQLDIEAEFKIKK
EDLEVVFADDSVEDDKEFSCETSGGATVRGALGPFGFSVLADQSLSEQTQVYFYVTKGKD
SKLKTFFCTDTSRSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIIEGFGQGGRTCIT
SRVYPTKAIYGATRLFLFNNANDAAITASFKVWQMNSAFIHPFSADDLGVPSST
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcaagctctgaatctctcttgccggtcagctctcaacaagatccattatctggttca
agatgcgactctatcccggagagccggagaagaagacctatcaaagttcatctcgccatc
tattctggttttctgttgatcgctttatacgttactctcgtcattacacacggcggatcc
gcacccaaaaatgatgtcaatgatgacaccacggtggagtcacgtgctcgtttggccggc
gtgtcggaaaagagcaacgaccatatttggaatctttccaatgatctgaaaggagaagcg
tttgcctggaacaatactgtgttgtcgtggcaacgaactgcgtttcatttccaacctgag
aaaaattggatgaacgatcctaatggtccattgttttataagggatggtaccatttcttc
tatcaatacaacccaaatgcagccgtgtggggtgacattgtttggggtcacgctgtatca
aaggatcttatccactggctttacctcccatttgccatggttcctgaccaatggtacgat
gctaacggcgtttggaccggttcagctactttccttgatgatggttctattgtcatgctc
tacactggttccaccgacaaatttgtacaagttcaaaaccttgcctatcctgaagaccct
aaagatccacttttgttgaaatggaccaagttctccggcaacccggttcttgtaccacct
ccaggtatcggtgctaaggacttccgtgacccaacaactgcatggaagacatcagacggg
aaatggcggatcattattggctccaaaatcaacagaaccggaatatctcttatttacgat
acaacagatttcaagacctacgagaagcatgagaccttgttgcaccaagtcccaaacact
ggaatgtgggagtgcgttgacttttatccagtgtccaagactaaagacaagggtcttgac
acttcggtcaatggaccggatgttaagcatatcattaaggctagcatggacgatactaga
attgaccattatgccattgggacatactatgactctaatgcaacatgggtccccgataat
ccttcaatcgatgtcgggattagtaccggtttgagatatgattacggtaaattttatgca
tccaagacgttttatgatcaacataagggacgaagaatcttgtggggttggatcggtgaa
tctgatagcgaagcagctgatgtacagaaggattggtcttctgttcaggggatcccgaga
actgttgcattggacacaaagacagggaagaacttagtccaatggccagttaaggaaatt
gagtctctgagattaagaagcaagaagttccacatgaaagttgaaccagggacagtggtt
ccggttgatgtaggccccaccgctcagctagacatagaggctgagttcaagatcaagaag
gaagatctcgaagtagtctttgcagatgactccgtggaggacgacaaggagttcagctgt
gaaacaagcggtggagccaccgtacgtggggctttaggacctttcggattctcggttctt
gctgaccaaagcttgtcagaacaaactcaggtttacttctatgtgactaagggaaaagat
tcgaaactcaaaacgttcttctgcactgacacgtcaaggtcgaccatggcaaatgatgtt
gtgaaaccggtatatggaagcttcgtaccggttctaaaaggagagaaattgaccatgaga
atcttggtggatcattcgataatagaggggtttggacaaggtggaagaacatgtattacc
tcaagggtttatccaacaaaggccatctacggagctacaaggcttttcttgttcaacaat
gctaatgatgcggctattacggcgtcgtttaaggtgtggcaaatgaacagcgcttttatt
catcctttctctgcggacgatttgggtgttccttctagcacctga

DBGET integrated database retrieval system